 |
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
Do025310.1 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
|
Family |
NF-YB |
Protein Properties |
Length: 107aa MW: 11045.5 Da PI: 6.2356 |
Description |
NF-YB family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
Do025310.1 | genome | Dichan | View CDS |
|
Signature Domain? help Back to Top |
 |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | NF-YB | 67.7 | 2.1e-21 | 1 | 67 | 17 | 83 |
NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyvepl 83
m+ + P n+ki+ dake v+ec ++fi+ v a+ +r+kr ++gddll a+++lGf+dyv pl
Do025310.1 1 MRLATPPNSKITGDAKEAVDECLAKFITIVNRAAAAEYKRDKRTNVTGDDLLLAMGNLGFDDYVGPL 67
67889***********************************************************998 PP
|
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Component of the NF-Y/HAP transcription factor complex. {ECO:0000250}. |
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Publications
? help Back to Top |
- Kikuchi S, et al.
Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] - Han X, et al.
Overexpression of the poplar NF-YB7 transcription factor confers drought tolerance and improves water-use efficiency in Arabidopsis. J. Exp. Bot., 2013. 64(14): p. 4589-601 [PMID:24006421] - Kim SK, et al.
OsNF-YC2 and OsNF-YC4 proteins inhibit flowering under long-day conditions in rice. Planta, 2016. 243(3): p. 563-76 [PMID:26542958] - Hwang YH, et al.
Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time. Plant Cell Rep., 2016. 35(4): p. 857-65 [PMID:26754793] - Hossain MA, et al.
Identification of Novel Components of the Unfolded Protein Response in Arabidopsis. Front Plant Sci, 2016. 7: p. 650 [PMID:27242851] - Zhao H, et al.
The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]
|