![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Do024356.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 100aa MW: 11667.4 Da PI: 6.6244 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 34.4 | 5e-11 | 55 | 94 | 4 | 45 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 +T +E++l+ + +++ G++ W++Ia +++ gRt++++ +w Do024356.1 55 FTDDEEDLFFRMHRLVGNR-WELIAGRIP-GRTAEEVEMFWS 94 9******************.*********.*******99986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00717 | 6.8E-9 | 51 | 99 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 1.79E-9 | 54 | 96 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 5.5E-11 | 55 | 95 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.38E-9 | 55 | 93 | No hit | No description |
PROSITE profile | PS50090 | 6.806 | 55 | 97 | IPR017877 | Myb-like domain |
Pfam | PF00249 | 1.5E-9 | 55 | 94 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:1900033 | Biological Process | negative regulation of trichome patterning | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 100 aa Download sequence Send to blast |
MKKIAPHSIG DHRIGGCNIF LHGLVLCSFA YFPDQLYTFM IIAEANSTAH HFVDFTDDEE 60 DLFFRMHRLV GNRWELIAGR IPGRTAEEVE MFWSKKHQEK |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MYB-type transcription factor involved in trichome cell specification. Acts as a negative regulator of trichome patterning and formation. May function by suppressing the expression of GL3. {ECO:0000269|PubMed:22168948}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Do024356.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU973098 | 4e-52 | EU973098.1 Zea mays clone 393226 hypothetical protein mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025816197.1 | 2e-30 | MYB-like transcription factor ETC3 | ||||
Swissprot | B3H4X8 | 5e-17 | TCL2_ARATH; MYB-like transcription factor TCL2 | ||||
TrEMBL | A0A1E5V4A8 | 1e-69 | A0A1E5V4A8_9POAL; Uncharacterized protein | ||||
STRING | Pavir.J30777.1.p | 1e-34 | (Panicum virgatum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP5275 | 31 | 57 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G30424.1 | 2e-19 | MYB_related family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|