PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Do002796.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
|
||||||||
Family | YABBY | ||||||||
Protein Properties | Length: 169aa MW: 19202.2 Da PI: 8.8221 | ||||||||
Description | YABBY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | YABBY | 50.1 | 1.1e-15 | 5 | 49 | 4 | 46 |
YABBY 4 fssseqvCyvqCnfCntila..vsvPstslfkvvtvrCGhCtsll 46 s+se++Cyv+C++Cnt+la v vP + l+ +vtv+CGhC +l Do002796.1 5 SSQSEHLCYVRCTYCNTVLAlqVGVPCKRLMDTVTVKCGHCNNLS 49 6789**************9744778*****************984 PP | |||||||
2 | YABBY | 85 | 2.1e-26 | 91 | 148 | 102 | 159 |
YABBY 102 senedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaakn 159 +++++e +pr+p v++PPek+ r Psaynrf++eeiqrika+ Pdi hreafs+aakn Do002796.1 91 PTSTHEASPRMPFVVKPPEKKHRLPSAYNRFMREEIQRIKAAKPDIPHREAFSMAAKN 148 56778899*************************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04690 | 3.7E-42 | 7 | 148 | IPR006780 | YABBY protein |
SuperFamily | SSF47095 | 2.36E-6 | 98 | 147 | IPR009071 | High mobility group box domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010254 | Biological Process | nectary development | ||||
GO:0010582 | Biological Process | floral meristem determinacy | ||||
GO:0048479 | Biological Process | style development |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 169 aa Download sequence Send to blast |
MDLVSSQSEH LCYVRCTYCN TVLALQVGVP CKRLMDTVTV KCGHCNNLSY LSPRPPMVQP 60 LSPTDHPLGP FQCQGPCNDC RRNQPLPLAS PTSTHEASPR MPFVVKPPEK KHRLPSAYNR 120 FMREEIQRIK AAKPDIPHRE AFSMAAKNER AKEQVIESFD IFKQIERSI |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Regulates carpel specification in flower development. Severe or intermediate mutation in DL causes complete or partial homeotic conversion of carpels into stamens without affecting the identities of other floral organs. Interacts antagonistically with class B genes and controls floral meristem determinacy. Regulates midrib formation in leaves probably by inducing cell proliferation in the central region of the leaf. {ECO:0000269|PubMed:14729915}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00220 | DAP | Transfer from AT1G69180 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Do002796.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB470268 | 0.0 | AB470268.1 Sorghum bicolor SbDL mRNA for DL related protein, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025797472.1 | 1e-111 | protein DROOPING LEAF isoform X1 | ||||
Swissprot | Q76EJ0 | 3e-97 | YABDL_ORYSJ; Protein DROOPING LEAF | ||||
TrEMBL | A0A1E5USC8 | 1e-122 | A0A1E5USC8_9POAL; Protein DROOPING LEAF | ||||
STRING | Pavir.Ia04690.1.p | 1e-110 | (Panicum virgatum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP5951 | 36 | 57 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69180.1 | 4e-48 | YABBY family protein |