PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Do002532.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 193aa MW: 21304.3 Da PI: 7.4189 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 104.4 | 9.9e-33 | 87 | 143 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 +ep+YVNaKQy++Il+RRq+Rak+e+e+kl k+rkpylheSRh+hAl+R+Rg gGrF Do002532.1 87 EEPVYVNAKQYNAILRRRQSRAKAESERKL-VKGRKPYLHESRHQHALKRARGAGGRF 143 69****************************.**************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 4.0E-35 | 85 | 146 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 36.53 | 86 | 146 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 4.5E-27 | 88 | 143 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 1.4E-23 | 89 | 111 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE pattern | PS00686 | 0 | 91 | 111 | IPR018362 | CCAAT-binding factor, conserved site |
PRINTS | PR00616 | 1.4E-23 | 120 | 143 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 193 aa Download sequence Send to blast |
EGIMTSVVHS VSDHRAEDQQ QKQPEPEDQQ EAPVTSSDSQ PTAQYAYPNI DPYYGSLYAA 60 YGGQPMMHPP LVGMHPTGLL LPTDAIEEPV YVNAKQYNAI LRRRQSRAKA ESERKLVKGR 120 KPYLHESRHQ HALKRARGAG GRFLNSKSDE KEENSDSSHK EKQNGVAPHE SSQPSTPPSP 180 NGASSANQAD SHK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 7e-21 | 86 | 150 | 1 | 65 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Do002532.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU969919 | 1e-176 | EU969919.1 Zea mays clone 337251 nuclear transcription factor Y subunit A-7 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004963231.1 | 1e-122 | nuclear transcription factor Y subunit A-7 | ||||
Swissprot | Q84JP1 | 2e-44 | NFYA7_ARATH; Nuclear transcription factor Y subunit A-7 | ||||
TrEMBL | A0A1E5VQX2 | 1e-139 | A0A1E5VQX2_9POAL; Nuclear transcription factor Y subunit A-7 (Fragment) | ||||
STRING | Si023231m | 1e-121 | (Setaria italica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP6555 | 38 | 53 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G30500.2 | 1e-37 | nuclear factor Y, subunit A7 |
Publications ? help Back to Top | |||
---|---|---|---|
|