PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium

Family

bZIP

Protein Properties

Length: 185aa MW: 20608.1 Da PI: 11.0384

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Do000158.1	genome	Dichan	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	48.4	2e-15	104	165	1	62
XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 +ke kr +r+ +NR++A+ R+RKka++ Le kvk Le++N+++ ++l++l++e + l++ Do000158.1 104 DKEHKRLKRLLRNRVSAQQARERKKAYLTDLEVKVKDLEKKNSEMEERLSTLQNENQMLRQI 165 5899*****************************************************99876 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	9.0E-15	104	168	IPR004827	Basic-leucine zipper domain
Pfam	PF00170	4.5E-14	105	166	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	12.289	106	169	IPR004827	Basic-leucine zipper domain
Gene3D	G3DSA:1.20.5.170	3.8E-16	108	168	No hit	No description
SuperFamily	SSF57959	4.88E-13	108	166	No hit	No description
CDD	cd14704	4.28E-17	109	160	No hit	No description
PROSITE pattern	PS00036	0	111	126	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009737	Biological Process	response to abscisic acid
GO:0009740	Biological Process	gibberellic acid mediated signaling pathway
GO:0010017	Biological Process	red or far-red light signaling pathway
GO:0010099	Biological Process	regulation of photomorphogenesis
GO:0010114	Biological Process	response to red light
GO:0010218	Biological Process	response to far red light
GO:0010224	Biological Process	response to UV-B
GO:0031539	Biological Process	positive regulation of anthocyanin metabolic process
GO:0042753	Biological Process	positive regulation of circadian rhythm
GO:0080167	Biological Process	response to karrikin
GO:0005634	Cellular Component	nucleus
GO:0003690	Molecular Function	double-stranded DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 185 aa Download sequence Send to blast
MQEQAASSRP SSSERSSSSA HHMDMERSSF LIGILLAFRF LFHATMTRME SDEEIRRVPE 60 LGLELPGGAS TSGREAGPGA GGPERAQSST AQASSRRRVR SPADKEHKRL KRLLRNRVSA 120 QQARERKKAY LTDLEVKVKD LEKKNSEMEE RLSTLQNENQ MLRQILKNTT VSRRGPGSTA 180 SGEGQ

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
2oqq_A	4e-15	129	168	3	42	Transcription factor HY5
2oqq_B	4e-15	129	168	3	42	Transcription factor HY5
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that promotes photomorphogenesis in the light and positively regulates fruit pigmentation and fruit nutritional quality. Probably acts downstream of the light receptor network and directly affects transcription of light-induced genes. {ECO:0000269\|PubMed:15178762}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00117	ampDAP	Transfer from AT5G11260	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Do000158.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT063353	1e-132	BT063353.1 Zea mays full-length cDNA clone ZM_BFc0055M22 mRNA, complete cds.
GenBank	KJ726945	1e-132	KJ726945.1 Zea mays clone pUT3491 bZIP transcription factor (bZIP61) mRNA, partial cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004951525.1	6e-97	transcription factor HY5
Swissprot	Q9SM50	9e-51	HY5_SOLLC; Transcription factor HY5
TrEMBL	A0A1E5VKH2	1e-129	A0A1E5VKH2_9POAL; Transcription factor HY5
STRING	Si018524m	2e-96	(Setaria italica)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP1408	38	111

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G11260.1	9e-39	bZIP family protein

Publications ? help Back to Top
Wang F, et al. Light Signaling-Dependent Regulation of Photoinhibition and Photoprotection in Tomato. Plant Physiol., 2018. 176(2): p. 1311-1326 [PMID:29146776] Liu CC, et al. The bZip transcription factor HY5 mediates CRY1a-induced anthocyanin biosynthesis in tomato. Plant Cell Environ., 2018. 41(8): p. 1762-1775 [PMID:29566255]