![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Dca6195.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
|
||||||||
Family | G2-like | ||||||||
Protein Properties | Length: 276aa MW: 31202.1 Da PI: 5.1347 | ||||||||
Description | G2-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | G2-like | 86.7 | 2.2e-27 | 57 | 110 | 2 | 55 |
G2-like 2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 +r+rWt+eLHe+F +av+qLGG e+AtP +l++m+v+gLt++hv+ HL kYR+ Dca6195.1 57 QRMRWTQELHEAFADAVSQLGGRERATPEDVLRVMNVEGLTIYHVRRHLLKYRI 110 8****************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 10.383 | 53 | 113 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 7.7E-13 | 55 | 110 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 3.7E-24 | 55 | 111 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 1.6E-18 | 57 | 110 | IPR006447 | Myb domain, plants |
Pfam | PF00249 | 5.9E-9 | 58 | 109 | IPR001005 | SANT/Myb domain |
Pfam | PF14379 | 5.5E-18 | 143 | 187 | IPR025756 | MYB-CC type transcription factor, LHEQLE-containing domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 276 aa Download sequence Send to blast |
MSRTWMDTGT TQSFQKVRFN ERHLSKEPLS LAELVVPRLE IQEQLSLLST AEVSTTQRMR 60 WTQELHEAFA DAVSQLGGRE RATPEDVLRV MNVEGLTIYH VRRHLLKYRI ASITLELSEG 120 NADDEMTDSA QESPVDLKTN ITTTKALRMQ IKLQKQLHEQ LEIQRKLQLR IEEQGKQLLQ 180 MLESRNKDTD ASQALAETSQ QGSKGKRQGL EGSCSVDQCT EADADESAPP MKCPRTDESL 240 EKFNLHFTVI VFKSQNSGDA EVSGSPAEKT ILSWTE |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6j4k_A | 4e-20 | 58 | 111 | 4 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j4k_B | 4e-20 | 58 | 111 | 4 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j5b_A | 4e-20 | 58 | 111 | 4 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j5b_C | 4e-20 | 58 | 111 | 4 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j5b_D | 4e-20 | 58 | 111 | 4 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j5b_F | 4e-20 | 58 | 111 | 4 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j5b_H | 4e-20 | 58 | 111 | 4 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j5b_J | 4e-20 | 58 | 111 | 4 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in phosphate starvation signaling. Binds to P1BS, an imperfect palindromic sequence 5'-GNATATNC-3', to promote the expression of inorganic phosphate (Pi) starvation-responsive genes. Functionally redundant with PHR2 and PHR3 in regulating Pi starvation response and Pi homeostasis. {ECO:0000250|UniProtKB:Q10LZ1}. | |||||
UniProt | Transcription factor involved in phosphate starvation signaling (PubMed:11511543, PubMed:17927693, PubMed:26586833). Binds as a dimer to P1BS, an imperfect palindromic sequence 5'-GNATATNC-3', to promote the expression of inorganic phosphate (Pi) starvation-responsive genes (PubMed:11511543, PubMed:20838596, PubMed:26586833). SPX1 is a competitive inhibitor of this DNA-binding (PubMed:25271326). PHR1 binding to its targets is low Pi-dependent (PubMed:25271326). Regulates the expression of miR399 (PubMed:20838596). Regulates the expression of IPS1 (At3g09922), a non-coding RNA that mimics the target of miR399 to block the cleavage of PHO2 under Pi-deficient conditions (PubMed:17643101). Regulates lipid remodeling and triacylglycerol accumulation during phosphorus starvation (PubMed:25680792). Required for the shoot-specific hypoxic response (PubMed:24753539). Regulates FER1 expression upon phosphate starvation, linking iron and phosphate homeostasis (PubMed:23788639). Contributes to the homeostasis of both sulfate and phosphate in plants under phosphate deficiency (PubMed:21261953). Required for adaptation to high light and retaining functional photosynthesis during phosphate starvation (PubMed:21910737). Involved in the coregulation of Zn and Pi homeostasis (PubMed:24420568). {ECO:0000269|PubMed:11511543, ECO:0000269|PubMed:17643101, ECO:0000269|PubMed:17927693, ECO:0000269|PubMed:20838596, ECO:0000269|PubMed:21261953, ECO:0000269|PubMed:21910737, ECO:0000269|PubMed:23788639, ECO:0000269|PubMed:24420568, ECO:0000269|PubMed:24753539, ECO:0000269|PubMed:25271326, ECO:0000269|PubMed:25680792, ECO:0000269|PubMed:26586833}. | |||||
UniProt | Transcription factor involved in phosphate starvation signaling (PubMed:18263782, PubMed:26082401). Binds to P1BS, an imperfect palindromic sequence 5'-GNATATNC-3', to promote the expression of inorganic phosphate (Pi) starvation-responsive genes (PubMed:26082401). Functionally redundant with PHR2 and PHR3 in regulating Pi starvation response and Pi homeostasis (PubMed:26082401). {ECO:0000269|PubMed:18263782, ECO:0000269|PubMed:26082401}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Not regulated by Pi starvation. {ECO:0000269|PubMed:18263782, ECO:0000269|PubMed:26082401}. | |||||
UniProt | INDUCTION: Only moderately up-regulated by Pi starvation. {ECO:0000269|PubMed:11511543}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010675144.1 | 2e-59 | PREDICTED: myb family transcription factor PHL13 | ||||
Swissprot | B8ANX9 | 4e-44 | PHR1_ORYSI; Protein PHOSPHATE STARVATION RESPONSE 1 | ||||
Swissprot | Q10LZ1 | 4e-44 | PHR1_ORYSJ; Protein PHOSPHATE STARVATION RESPONSE 1 | ||||
Swissprot | Q94CL7 | 3e-44 | PHR1_ARATH; Protein PHOSPHATE STARVATION RESPONSE 1 | ||||
TrEMBL | Q9M620 | 3e-58 | Q9M620_MESCR; CDPK substrate protein 1 | ||||
STRING | XP_010675144.1 | 8e-59 | (Beta vulgaris) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G28610.1 | 1e-46 | phosphate starvation response 1 |