![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Dca13546.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
|
||||||||
Family | G2-like | ||||||||
Protein Properties | Length: 86aa MW: 9518.16 Da PI: 11.6592 | ||||||||
Description | G2-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | G2-like | 105.2 | 3.8e-33 | 14 | 67 | 2 | 55 |
G2-like 2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 pr+rWt++LH++Fv+av+ LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+ Dca13546.1 14 PRMRWTSTLHSHFVHAVQLLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRT 67 9****************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46689 | 6.81E-17 | 11 | 68 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 1.8E-29 | 12 | 68 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 3.8E-25 | 14 | 67 | IPR006447 | Myb domain, plants |
Pfam | PF00249 | 3.7E-8 | 15 | 66 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0080060 | Biological Process | integument development | ||||
GO:0005618 | Cellular Component | cell wall | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 86 aa Download sequence Send to blast |
MIGGGVLKRS IRAPRMRWTS TLHSHFVHAV QLLGGHERAT PKSVLELMNV KDLTLAHVKS 60 HLQMYRTVKS TEKASSSPGI QIGFSI |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6j4k_A | 2e-19 | 15 | 69 | 4 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j4k_B | 2e-19 | 15 | 69 | 4 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j5b_A | 2e-19 | 15 | 69 | 4 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j5b_C | 2e-19 | 15 | 69 | 4 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j5b_D | 2e-19 | 15 | 69 | 4 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j5b_F | 2e-19 | 15 | 69 | 4 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j5b_H | 2e-19 | 15 | 69 | 4 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j5b_J | 2e-19 | 15 | 69 | 4 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that regulates carpel integuments formation. Required for the specification of polarity in the ovule inner integument. Modulates the content of flavonols and proanthocyanidin in seeds. {ECO:0000269|PubMed:16623911, ECO:0000269|PubMed:19054366, ECO:0000269|PubMed:20444210}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00107 | PBM | Transfer from AT5G42630 | Download |
![]() |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008444661.1 | 3e-42 | PREDICTED: probable transcription factor KAN4 | ||||
Swissprot | Q9FJV5 | 4e-41 | KAN4_ARATH; Probable transcription factor KAN4 | ||||
TrEMBL | A0A1S3BAW6 | 7e-41 | A0A1S3BAW6_CUCME; probable transcription factor KAN4 | ||||
STRING | XP_004152789.1 | 5e-43 | (Cucumis sativus) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G42630.2 | 3e-44 | G2-like family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|