 |
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
DCAR_031125 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
|
Family |
HB-other |
Protein Properties |
Length: 88aa MW: 10535 Da PI: 9.4749 |
Description |
HB-other family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
DCAR_031125 | genome | ARS-USDA | View CDS |
|
Signature Domain? help Back to Top |
 |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | Homeobox | 30 | 9e-10 | 29 | 63 | 21 | 55 |
HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
Homeobox 21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55
k +yp+++++ LA+++gL+++q+ +WF N+R ++
DCAR_031125 29 KWPYPTEADKNFLAESTGLDQKQINNWFINQRKRH 63
569*****************************985 PP
|
Gene Ontology ? help Back to Top |
GO Term |
GO Category |
GO Description |
GO:0006355 | Biological Process | regulation of transcription, DNA-templated |
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Plays a role in meristem function. Contributes to the shoot apical meristem (SAM) maintenance and organ separation by controlling boundary establishment in embryo in a CUC1, CUC2 and STM-dependent manner. Involved in maintaining cells in an undifferentiated, meristematic state. Probably binds to the DNA sequence 5'-TGAC-3'. {ECO:0000269|PubMed:16798887}. |
Regulation -- Description ? help
Back to Top |
Source |
Description |
UniProt | INDUCTION: Seems to be repressed by AS2 and AS1 but induced by STM, CUC1 and CUC2. {ECO:0000269|PubMed:11311158, ECO:0000269|PubMed:16798887}. |