PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | DCAR_028002 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 157aa MW: 17668.4 Da PI: 9.9409 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 123 | 1e-38 | 45 | 102 | 2 | 59 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59 ++k+++cprC+s++tkfCy+nny+++qPr+fC++C+ryWt+GGalrnvPvG+grrknk DCAR_028002 45 PDKIIPCPRCKSMETKFCYFNNYNVNQPRHFCRGCQRYWTAGGALRNVPVGAGRRKNK 102 7899*****************************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD007478 | 9.0E-29 | 44 | 102 | IPR003851 | Zinc finger, Dof-type |
Pfam | PF02701 | 4.3E-32 | 47 | 102 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 28.435 | 49 | 103 | IPR003851 | Zinc finger, Dof-type |
PROSITE pattern | PS01361 | 0 | 51 | 87 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 157 aa Download sequence Send to blast |
MAKVHKNKEL PKIKLFGKTI LQGAQVLKNE EDVNKEKDQL IDKKPDKIIP CPRCKSMETK 60 FCYFNNYNVN QPRHFCRGCQ RYWTAGGALR NVPVGAGRRK NKPPCGVLDG FSECSMFNFN 120 WTVEEWHRAA VAGANEDPGS IIPAKRRRSI LGGESC* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Transcriptional repressor of 'CONSTANS' expression (By similarity). Regulates a photoperiodic flowering response. {ECO:0000250, ECO:0000269|PubMed:19619493}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Circadian-regulation. The transcript level rises progressively from dawn and decreases during the night. {ECO:0000269|PubMed:19619493}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017222259.1 | 1e-114 | PREDICTED: cyclic dof factor 4-like | ||||
Swissprot | O22967 | 3e-50 | CDF4_ARATH; Cyclic dof factor 4 | ||||
TrEMBL | A0A175YLI8 | 1e-113 | A0A175YLI8_DAUCS; Uncharacterized protein | ||||
STRING | XP_008225286.1 | 1e-58 | (Prunus mume) | ||||
STRING | EMJ13375 | 9e-59 | (Prunus persica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA7240 | 22 | 32 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G34140.1 | 1e-52 | Dof family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | DCAR_028002 |
Publications ? help Back to Top | |||
---|---|---|---|
|