![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | DCAR_012980 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 199aa MW: 22641.5 Da PI: 7.4665 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 46.9 | 6.1e-15 | 11 | 58 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +grWT+ Ed l+ +v+++G +W++++r g+ R++ +c++rw ++l DCAR_012980 11 KGRWTPGEDFMLASYVHEHGASNWNLVPRNTGLERSGISCRLRWMNHL 58 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 41.8 | 2.5e-13 | 64 | 110 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T E+++++++ +++G++ W Ia+ ++ gRt++ +k++w+++l DCAR_012980 64 RGKFTHHEEQIIIHYYARFGPHGWVNIAAQLP-GRTAYGVKNYWHNHL 110 89******************************.*************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 11.057 | 6 | 58 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 4.23E-25 | 8 | 106 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 6.1E-10 | 10 | 60 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.2E-13 | 11 | 58 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.4E-21 | 12 | 65 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 8.24E-10 | 13 | 58 | No hit | No description |
PROSITE profile | PS51294 | 21.731 | 59 | 114 | IPR017930 | Myb domain |
SMART | SM00717 | 1.4E-9 | 63 | 112 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 6.6E-11 | 64 | 110 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.4E-20 | 66 | 114 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 4.23E-9 | 66 | 110 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 199 aa Download sequence Send to blast |
MVRPPVPDAM KGRWTPGEDF MLASYVHEHG ASNWNLVPRN TGLERSGISC RLRWMNHLNP 60 DIKRGKFTHH EEQIIIHYYA RFGPHGWVNI AAQLPGRTAY GVKNYWHNHL KKKVDIVNGH 120 VDEPIENPIE NPVVAPVYQA PPFPAPSFAR EREDFDYPFI ARAPSFGPYL PTAQNPSFAR 180 EHEGSAYQPS IFTPLDHD* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 4e-23 | 6 | 115 | 2 | 109 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator involved in the activation of cuticular wax biosynthesis under drought stress. Binds directly to the promoters of genes involved in cuticular wax biosynthesis. Transactivates WSD1, KCS2/DAISY, CER1, CER2, FAR3 and ECR genes (PubMed:25305760, PubMed:27577115). Functions together with MYB96 in the activation of cuticular wax biosynthesis (PubMed:27577115). {ECO:0000269|PubMed:25305760, ECO:0000269|PubMed:27577115}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salt stress, osmotic shock and abscisic acid (ABA). {ECO:0000269|PubMed:25305760}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017245833.1 | 1e-147 | PREDICTED: transcription factor MYB30-like | ||||
Swissprot | Q9SN78 | 4e-40 | MYB94_ARATH; Transcription factor MYB94 | ||||
TrEMBL | A0A165Z678 | 1e-145 | A0A165Z678_DAUCS; Uncharacterized protein | ||||
STRING | XP_010532312.1 | 5e-39 | (Tarenaya hassleriana) | ||||
STRING | XP_010546059.1 | 1e-38 | (Tarenaya hassleriana) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G47600.1 | 2e-42 | myb domain protein 94 |
Link Out ? help Back to Top | |
---|---|
Phytozome | DCAR_012980 |
Publications ? help Back to Top | |||
---|---|---|---|
|