![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | DCAR_004007 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 158aa MW: 17774.4 Da PI: 9.11 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 124.7 | 2.9e-39 | 54 | 111 | 2 | 59 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59 +ek+++cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GGalrnvPvG+grrk k DCAR_004007 54 PEKIVPCPRCKSMETKFCYFNNYNVNQPRHFCKGCQRYWTAGGALRNVPVGAGRRKMK 111 78999***************************************************87 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD007478 | 4.0E-28 | 54 | 111 | IPR003851 | Zinc finger, Dof-type |
Pfam | PF02701 | 3.4E-32 | 56 | 111 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 28.025 | 58 | 112 | IPR003851 | Zinc finger, Dof-type |
PROSITE pattern | PS01361 | 0 | 60 | 96 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:1902455 | Biological Process | negative regulation of stem cell population maintenance | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 158 aa Download sequence Send to blast |
MAKVQNKQQD VQGIKLFGKT IAVPEKQEQD EQPVLKEPKE DEKNEDDQNL DKKPEKIVPC 60 PRCKSMETKF CYFNNYNVNQ PRHFCKGCQR YWTAGGALRN VPVGAGRRKM KLPGLGGVEG 120 FSESCSMFEH VGSGVQPLDM AVDGGFRHVF PAKRRRC* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Transcriptional repressor of 'CONSTANS' expression (By similarity). Regulates a photoperiodic flowering response. {ECO:0000250, ECO:0000269|PubMed:19619493}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Circadian-regulation. The transcript level rises progressively from dawn and decreases during the night. {ECO:0000269|PubMed:19619493}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AP006693 | 5e-37 | AP006693.1 Lotus japonicus genomic DNA, chromosome 4, clone: LjT35C17, TM0399, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017217017.1 | 1e-114 | PREDICTED: dof zinc finger protein DOF1.5 | ||||
Swissprot | O22967 | 1e-51 | CDF4_ARATH; Cyclic dof factor 4 | ||||
TrEMBL | A0A166IPN2 | 1e-113 | A0A166IPN2_DAUCS; Uncharacterized protein | ||||
STRING | VIT_10s0003g01260.t01 | 2e-56 | (Vitis vinifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA7240 | 22 | 32 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G34140.1 | 3e-50 | Dof family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | DCAR_004007 |
Publications ? help Back to Top | |||
---|---|---|---|
|