PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cucsa.395100.1 | ||||||||
Common Name | Csa_2G351680, LOC105434748 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 137aa MW: 15316.5 Da PI: 8.2131 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 97.9 | 1.1e-30 | 13 | 108 | 1 | 96 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 aCaaCk++rrkC+ +C+lapyfpa++ ++f+nv+klFG++nvlk+l+ l+ +r +a++++++eA++ra d v G++++i +lq++++ l+a+ Cucsa.395100.1 13 ACAACKFHRRKCSVECPLAPYFPANRLQDFENVRKLFGVKNVLKTLAGLDSYNRFKAAECMIFEANCRALDLVGGCCQIIPRLQNEIALLEAQHR 107 7***************************************************************************************9999876 PP DUF260 96 l 96 + Cucsa.395100.1 108 H 108 5 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 20.43 | 12 | 113 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 1.3E-30 | 13 | 107 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 137 aa Download sequence Send to blast |
MDINFPTTTQ APACAACKFH RRKCSVECPL APYFPANRLQ DFENVRKLFG VKNVLKTLAG 60 LDSYNRFKAA ECMIFEANCR ALDLVGGCCQ IIPRLQNEIA LLEAQHRHIL RQLQISRQTA 120 AAISQLGAIP SEFDSDX |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 3e-21 | 6 | 131 | 3 | 124 | LOB family transfactor Ramosa2.1 |
5ly0_B | 3e-21 | 6 | 131 | 3 | 124 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681823 | 1e-157 | LN681823.1 Cucumis melo genomic scaffold, anchoredscaffold00014. | |||
GenBank | LN713257 | 1e-157 | LN713257.1 Cucumis melo genomic chromosome, chr_3. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011650178.1 | 6e-97 | PREDICTED: LOB domain-containing protein 22-like | ||||
TrEMBL | A0A0A0LNK6 | 1e-95 | A0A0A0LNK6_CUCSA; Uncharacterized protein | ||||
STRING | XP_008444461.1 | 1e-69 | (Cucumis melo) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF4133 | 32 | 59 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G47870.1 | 4e-21 | LOB domain-containing protein 27 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Cucsa.395100.1 |
Entrez Gene | 105434748 |
Publications ? help Back to Top | |||
---|---|---|---|
|