PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cucsa.358620.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 64aa MW: 6954.1 Da PI: 10.4002 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 48.1 | 3.3e-15 | 21 | 63 | 3 | 45 |
DUF260 3 aaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkl 45 a Ck+lrr+C k+Cvla yfp ++p kf ++h +FGasn++kl Cucsa.358620.1 21 ATCKILRRRCDKKCVLAAYFPPSKPLKFTITHCIFGASNIIKL 63 78**************************************997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 13.178 | 18 | 64 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 8.0E-14 | 21 | 63 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 64 aa Download sequence Send to blast |
AVASPSPSPT VQASVVVNLY ATCKILRRRC DKKCVLAAYF PPSKPLKFTI THCIFGASNI 60 IKLX |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004147299.1 | 1e-20 | PREDICTED: LOB domain-containing protein 1-like | ||||
Swissprot | Q9SK08 | 5e-17 | LBD11_ARATH; LOB domain-containing protein 11 | ||||
TrEMBL | A0A1S3CK12 | 5e-19 | A0A1S3CK12_CUCME; LOB domain-containing protein 1-like | ||||
STRING | XP_004147299.1 | 5e-20 | (Cucumis sativus) | ||||
STRING | XP_004161319.1 | 5e-20 | (Cucumis sativus) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G28500.1 | 2e-19 | LOB domain-containing protein 11 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Cucsa.358620.1 |