PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis

Family

Dof

Protein Properties

Length: 118aa MW: 13205.6 Da PI: 10.3083

Description

Dof family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Cucsa.341290.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	zf-Dof	130.3	5.2e-41	16	75	2	61
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 ++++lkcprCdstntkfCyynny+lsqPr+fCk+CrryWtkGGalrn+PvGgg+rkn k+ Cucsa.341290.1 16 EQEQLKCPRCDSTNTKFCYYNNYNLSQPRHFCKNCRRYWTKGGALRNIPVGGGTRKNSKR 75 5789****************************************************9876 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD007478	3.0E-30	11	75	IPR003851	Zinc finger, Dof-type
Pfam	PF02701	4.4E-34	18	74	IPR003851	Zinc finger, Dof-type
PROSITE profile	PS50884	29.571	20	74	IPR003851	Zinc finger, Dof-type
PROSITE pattern	PS01361	0	22	58	IPR003851	Zinc finger, Dof-type

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0010200	Biological Process	response to chitin
GO:0044212	Molecular Function	transcription regulatory region DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 118 aa Download sequence Send to blast
MQDPSTFQPI KPQFPEQEQL KCPRCDSTNT KFCYYNNYNL SQPRHFCKNC RRYWTKGGAL 60 RNIPVGGGTR KNSKRAVAAT VKRPPSSTSS THPNTITVPD HNPIRGYGGG LDIPGSFX

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00199	DAP	Transfer from AT1G51700	Download

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	LN681827	1e-174	LN681827.1 Cucumis melo genomic scaffold, anchoredscaffold00018.
GenBank	LN713258	1e-174	LN713258.1 Cucumis melo genomic chromosome, chr_4.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_008447593.1	1e-76	PREDICTED: dof zinc finger protein DOF1.7-like
Swissprot	O82155	5e-41	DOF17_ARATH; Dof zinc finger protein DOF1.7
TrEMBL	A0A0A0LDG2	2e-82	A0A0A0LDG2_CUCSA; Uncharacterized protein
STRING	XP_004146854.1	4e-83	(Cucumis sativus)
STRING	XP_004154872.1	4e-83	(Cucumis sativus)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF6181	33	51

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G51700.1	7e-43	DOF zinc finger protein 1

Link Out ? help Back to Top
Phytozome	Cucsa.341290.1

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ren Y, et al. An integrated genetic and cytogenetic map of the cucumber genome. PLoS ONE, 2009. 4(6): p. e5795 [PMID:19495411] Guo S, et al. Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types. BMC Genomics, 2010. 11: p. 384 [PMID:20565788] Li Z, et al. RNA-Seq improves annotation of protein-coding genes in the cucumber genome. BMC Genomics, 2011. 12: p. 540 [PMID:22047402] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444]