PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cucsa.330590.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 69aa MW: 7470.11 Da PI: 10.1905 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 44.4 | 4.7e-14 | 21 | 64 | 3 | 46 |
DUF260 3 aaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkll 46 a Ck+lr +C+k+Cvl yfp ++p kf +vh +FGasn++kll Cucsa.330590.1 21 ATCKILRWRCTKKCVLVAYFPPSEPLKFIIVHCIFGASNIIKLL 64 79****************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 12.592 | 18 | 68 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 1.5E-13 | 21 | 64 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 69 aa Download sequence Send to blast |
VVASPSPSPT VQASVVVISY ATCKILRWRC TKKCVLVAYF PPSEPLKFII VHCIFGASNI 60 IKLLLVRP* |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004147299.1 | 5e-21 | PREDICTED: LOB domain-containing protein 1-like | ||||
Swissprot | Q9SK08 | 2e-15 | LBD11_ARATH; LOB domain-containing protein 11 | ||||
TrEMBL | A0A1S3CK12 | 2e-18 | A0A1S3CK12_CUCME; LOB domain-containing protein 1-like | ||||
STRING | XP_004147299.1 | 2e-20 | (Cucumis sativus) | ||||
STRING | XP_004161319.1 | 2e-20 | (Cucumis sativus) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G28500.1 | 7e-18 | LOB domain-containing protein 11 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Cucsa.330590.1 |