PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis

Family

HD-ZIP

Protein Properties

Length: 216aa MW: 25050 Da PI: 6.314

Description

HD-ZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Cucsa.311660.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	56.7	4e-18	63	115	4	56
-SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS Homeobox 4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 +++++ +q++ Le++Fe ++++ +++ ++A++l+L+ rqV++WFqNrRa++k Cucsa.311660.1 63 KRRLKLDQVKGLERHFEVENKLEPDRKMKIAAELELEPRQVTIWFQNRRARWK 115 4478889*********************************************9 PP
2	HD-ZIP_I/II	120.1	1.2e-38	61	153	1	93
HD-ZIP_I/II 1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 e+krrl+ +qvk LE++Fe e+kLep+rK+++a eL+l+prqv +WFqnrRAR+ktkqlEkdye+Lk +ydalk + + Leke+++L++++ke Cucsa.311660.1 61 ERKRRLKLDQVKGLERHFEVENKLEPDRKMKIAAELELEPRQVTIWFQNRRARWKTKQLEKDYEVLKLNYDALKLDYDVLEKENASLASKVKE 153 69***************************************************************************************9987 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	1.3E-19	45	118	IPR009057	Homeodomain-like
SuperFamily	SSF46689	5.13E-18	49	119	IPR009057	Homeodomain-like
PROSITE profile	PS50071	16.147	57	117	IPR001356	Homeobox domain
SMART	SM00389	4.3E-16	60	121	IPR001356	Homeobox domain
CDD	cd00086	5.35E-13	62	118	No hit	No description
Pfam	PF00046	2.5E-15	63	115	IPR001356	Homeobox domain
PROSITE pattern	PS00027	0	92	115	IPR017970	Homeobox, conserved site
Pfam	PF02183	4.0E-15	117	158	IPR003106	Leucine zipper, homeobox-associated

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 216 aa Download sequence Send to blast
MKRFSHSDSL DSFISFFSPK DQQQNSKGIG GYSKEFQAML DSLEEEDNSE DGGSSGGSAP 60 ERKRRLKLDQ VKGLERHFEV ENKLEPDRKM KIAAELELEP RQVTIWFQNR RARWKTKQLE 120 KDYEVLKLNY DALKLDYDVL EKENASLASK VKELREKVNR EMKKGSMEKD SNRDGNSYIS 180 MLNSNNQFQF TKAMNEDQSL VNFCSVDQAP SLHYW*

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	60	65	ERKRRL
2	109	117	RRARWKTKQ

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor that acts as a positive regulator of ABA-responsiveness, mediating the inhibitory effect of ABA on growth during seedling establishment. Binds to the DNA sequence 5'-CAATNATTG-3'. {ECO:0000269\|PubMed:12678559}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Down-regulated by abscisic acid (ABA) and by salt stress. {ECO:0000269\|PubMed:12678559, ECO:0000269\|PubMed:16055682}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	LN681824	0.0	LN681824.1 Cucumis melo genomic scaffold, anchoredscaffold01596.
GenBank	LN713258	0.0	LN713258.1 Cucumis melo genomic chromosome, chr_4.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004136274.1	1e-158	PREDICTED: homeobox-leucine zipper protein ATHB-6-like
Swissprot	P46667	7e-46	ATHB5_ARATH; Homeobox-leucine zipper protein ATHB-5
TrEMBL	A0A0A0LHK6	1e-156	A0A0A0LHK6_CUCSA; Uncharacterized protein
STRING	XP_004136274.1	1e-157	(Cucumis sativus)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF1868	34	89

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G65310.1	5e-43	homeobox protein 5

Link Out ? help Back to Top
Phytozome	Cucsa.311660.1
Entrez Gene	101209840

Publications ? help Back to Top
Ren Y, et al. An integrated genetic and cytogenetic map of the cucumber genome. PLoS ONE, 2009. 4(6): p. e5795 [PMID:19495411] Guo S, et al. Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types. BMC Genomics, 2010. 11: p. 384 [PMID:20565788] Li Z, et al. RNA-Seq improves annotation of protein-coding genes in the cucumber genome. BMC Genomics, 2011. 12: p. 540 [PMID:22047402] Cassan-Wang H, et al. Identification of novel transcription factors regulating secondary cell wall formation in Arabidopsis. Front Plant Sci, 2013. 4: p. 189 [PMID:23781226] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Song L, et al. A transcription factor hierarchy defines an environmental stress response network. Science, 2017. [PMID:27811239] Stamm P, et al. The Transcription Factor ATHB5 Affects GA-Mediated Plasticity in Hypocotyl Cell Growth during Seed Germination. Plant Physiol., 2017. 173(1): p. 907-917 [PMID:27872245]