PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cucsa.300810.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 72aa MW: 7652.94 Da PI: 7.8326 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 30.6 | 9.3e-10 | 20 | 51 | 1 | 32 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfan 32 +C Ck+l ++C+++C+lapyfp ++p kf Cucsa.300810.1 20 PCLECKILHQRCVEKCILAPYFPPSEPLKFTL 51 699***********************999976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 10.855 | 19 | 71 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 3.2E-8 | 20 | 51 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 72 aa Download sequence Send to blast |
SPSSSPSPSP IVQASVVVSP CLECKILHQR CVEKCILAPY FPPSEPLKFT LLTASSALAT 60 SSNCLWYFLN P* |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_022949099.1 | 6e-15 | LOB domain-containing protein 1-like | ||||
Swissprot | Q9LQR0 | 3e-12 | LBD1_ARATH; LOB domain-containing protein 1 | ||||
Swissprot | Q9SK08 | 4e-12 | LBD11_ARATH; LOB domain-containing protein 11 | ||||
TrEMBL | A0A2Z7BKX0 | 8e-14 | A0A2Z7BKX0_9LAMI; LOB domain-containing protein 11-like | ||||
STRING | XP_008463550.1 | 9e-14 | (Cucumis melo) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G28500.1 | 1e-11 | LOB domain-containing protein 11 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Cucsa.300810.1 |