PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Cucsa.260210.1

Common Name

Csa_3G115040, LOC101218431

Organism

Cucumis sativus

Taxonomic ID

3659

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis

Family

Dof

Protein Properties

Length: 128aa MW: 13991.6 Da PI: 10.1006

Description

Dof family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Cucsa.260210.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	zf-Dof	127.6	3.7e-40	36	92	6	62
zf-Dof 6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 +kcprCdstntkfCyynnysl+qPr+fCk+CrryWtkGGalrnvP+Ggg+rk kk + Cucsa.260210.1 36 VKCPRCDSTNTKFCYYNNYSLTQPRHFCKTCRRYWTKGGALRNVPIGGGCRKTKKLK 92 79***************************************************9876 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD007478	1.0E-25	28	90	IPR003851	Zinc finger, Dof-type
Pfam	PF02701	9.9E-34	36	90	IPR003851	Zinc finger, Dof-type
PROSITE profile	PS50884	29.255	36	90	IPR003851	Zinc finger, Dof-type
PROSITE pattern	PS01361	0	38	74	IPR003851	Zinc finger, Dof-type

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 128 aa Download sequence Send to blast
MKNSLEEEIR QKSSSGRRKE NKNGDNCEDQ ELLGGVKCPR CDSTNTKFCY YNNYSLTQPR 60 HFCKTCRRYW TKGGALRNVP IGGGCRKTKK LKSSSSSSSS AKFFTGIIPP LPVPPPSVDF 120 GGTGGGGX

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	LN681857	0.0	LN681857.1 Cucumis melo genomic scaffold, anchoredscaffold00023.
GenBank	LN713260	0.0	LN713260.1 Cucumis melo genomic chromosome, chr_6.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004134269.1	3e-89	PREDICTED: dof zinc finger protein DOF5.7
Swissprot	Q9LSL6	2e-32	DOF57_ARATH; Dof zinc finger protein DOF5.7
TrEMBL	A0A0A0L2T9	6e-88	A0A0A0L2T9_CUCSA; Uncharacterized protein
STRING	XP_004134269.1	1e-88	(Cucumis sativus)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF3854	34	60

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G65590.1	1e-34	Dof family protein

Link Out ? help Back to Top
Phytozome	Cucsa.260210.1
Entrez Gene	101218431

Publications ? help Back to Top
Ren Y, et al. An integrated genetic and cytogenetic map of the cucumber genome. PLoS ONE, 2009. 4(6): p. e5795 [PMID:19495411] Guo S, et al. Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types. BMC Genomics, 2010. 11: p. 384 [PMID:20565788] Li Z, et al. RNA-Seq improves annotation of protein-coding genes in the cucumber genome. BMC Genomics, 2011. 12: p. 540 [PMID:22047402] Castorina G,Fox S,Tonelli C,Galbiati M,Conti L A novel role for STOMATAL CARPENTER 1 in stomata patterning. BMC Plant Biol., 2016. 16(1): p. 172 [PMID:27484174]