PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis

Family

MYB

Protein Properties

Length: 203aa MW: 23930.2 Da PI: 8.3075

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Cucsa.238540.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	60.5	3.7e-19	11	58	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT +Ed+ll ++vk +G g+W+++a+ g++Rt+k+c++rw +yl Cucsa.238540.1 11 KGPWTSDEDKLLCEYVKVHGEGRWNSVAKGSGLNRTGKSCRLRWVNYL 58 79********************************************97 PP
2	Myb_DNA-binding	50.4	5e-16	68	108	5	47
-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 T++E+ +++++++++G++ W+tIar+++ gRt++++k++w+++ Cucsa.238540.1 68 TPQEEGIIIELHALWGNK-WSTIARYLP-GRTDNEIKNYWRTH 108 9***************.*****.**********97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	6.4E-22	5	60	IPR009057	Homeodomain-like
PROSITE profile	PS51294	23.571	6	62	IPR017930	Myb domain
SuperFamily	SSF46689	7.26E-31	9	105	IPR009057	Homeodomain-like
SMART	SM00717	6.8E-16	10	60	IPR001005	SANT/Myb domain
Pfam	PF00249	1.5E-17	11	58	IPR001005	SANT/Myb domain
CDD	cd00167	1.40E-10	13	58	No hit	No description
Gene3D	G3DSA:1.10.10.60	2.1E-22	61	111	IPR009057	Homeodomain-like
SMART	SM00717	3.9E-13	63	111	IPR001005	SANT/Myb domain
PROSITE profile	PS51294	19.168	63	113	IPR017930	Myb domain
Pfam	PF00249	6.5E-14	68	108	IPR001005	SANT/Myb domain
CDD	cd00167	3.75E-9	68	109	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009737	Biological Process	response to abscisic acid
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 203 aa Download sequence Send to blast
MEGKEEQEWR KGPWTSDEDK LLCEYVKVHG EGRWNSVAKG SGLNRTGKSC RLRWVNYLRP 60 GLKRCHLTPQ EEGIIIELHA LWGNKWSTIA RYLPGRTDNE IKNYWRTHFK KMKPKRKSKI 120 MVGKTDNKTM PPVTRCEEHV MELMKPYDSD NNDLSMVFTE PTAMEDHEQT YYLSMVYQDL 180 TNWAAEKKEE SLWEWPLGGF RE*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	3e-25	11	111	7	106	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. {ECO:0000305}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00388	DAP	Transfer from AT3G30210	Download

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Isoform MYB59-1 is induced by jasmonate (JA), salicylic acid (SA), gibberellic acid (GA), and ethylene. Also induced by cadmium (Cd). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:16531467}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	LN681889	7e-83	LN681889.1 Cucumis melo genomic scaffold, anchoredscaffold00051.
GenBank	LN713263	7e-83	LN713263.1 Cucumis melo genomic chromosome, chr_9.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004141594.1	1e-150	PREDICTED: transcription factor MYB59-like
Swissprot	Q4JL84	7e-50	MYB59_ARATH; Transcription factor MYB59
TrEMBL	A0A0A0KSK2	1e-147	A0A0A0KSK2_CUCSA; Uncharacterized protein
STRING	XP_004156219.1	1e-131	(Cucumis sativus)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF1182	34	108

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G30210.1	5e-62	myb domain protein 121

Link Out ? help Back to Top
Phytozome	Cucsa.238540.1

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ren Y, et al. An integrated genetic and cytogenetic map of the cucumber genome. PLoS ONE, 2009. 4(6): p. e5795 [PMID:19495411] Guo S, et al. Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types. BMC Genomics, 2010. 11: p. 384 [PMID:20565788] Li Z, et al. RNA-Seq improves annotation of protein-coding genes in the cucumber genome. BMC Genomics, 2011. 12: p. 540 [PMID:22047402] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Nishida S,Kakei Y,Shimada Y,Fujiwara T Genome-wide analysis of specific alterations in transcript structure and accumulation caused by nutrient deficiencies in Arabidopsis thaliana. Plant J., 2017. 91(4): p. 741-753 [PMID:28586097] Hickman R, et al. Architecture and Dynamics of the Jasmonic Acid Gene Regulatory Network. Plant Cell, 2017. 29(9): p. 2086-2105 [PMID:28827376]