![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cucsa.232630.1 | ||||||||
Common Name | Csa_2G360620, LOC101203523 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 184aa MW: 21150.9 Da PI: 10.2212 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 58 | 2.2e-18 | 9 | 54 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g+W++eEd +l ++v ++G ++W++I+r++ gR++k+c++rw + Cucsa.232630.1 9 KGPWSAEEDRILTQLVDRYGARNWSLISRYIK-GRSGKSCRLRWCNQ 54 79*****************************9.***********985 PP | |||||||
2 | Myb_DNA-binding | 54.5 | 2.7e-17 | 63 | 105 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 ++++ Ede ++ a++++G++ W+tIar ++ gRt++ +k++w++ Cucsa.232630.1 63 PFSPTEDETILAAHARFGNR-WATIARLLP-GRTDNAVKNHWNST 105 79******************.*********.***********986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 27.466 | 4 | 59 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.12E-31 | 6 | 102 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 8.5E-16 | 8 | 57 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.2E-24 | 10 | 62 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 4.44E-14 | 11 | 53 | No hit | No description |
Pfam | PF13921 | 1.2E-17 | 12 | 70 | No hit | No description |
SMART | SM00717 | 1.9E-14 | 60 | 108 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 20.413 | 61 | 110 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 6.0E-23 | 63 | 109 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 7.42E-11 | 63 | 106 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 184 aa Download sequence Send to blast |
GLRRPEKIKG PWSAEEDRIL TQLVDRYGAR NWSLISRYIK GRSGKSCRLR WCNQLSPNVE 60 HRPFSPTEDE TILAAHARFG NRWATIARLL PGRTDNAVKN HWNSTLKRRA REQQHHQQLV 120 MDGITPECHG ITPPGIGGVR TTAAEERRVE SFPAGFWDAM RDVIAREVRE YMTTTFMENP 180 EFQ* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 3e-41 | 5 | 110 | 3 | 108 | B-MYB |
1h88_C | 1e-40 | 5 | 110 | 54 | 159 | MYB PROTO-ONCOGENE PROTEIN |
1h89_C | 1e-40 | 5 | 110 | 54 | 159 | MYB PROTO-ONCOGENE PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in auxin response. Functions in auxin signal transduction and modulates lateral root growth. Interacts with ARF response factors to promote auxin-responsive gene expression (PubMed:17675404). In response to auxin, binds sequence-specific motifs in the promoter of the auxin-responsive gene IAA19, and activates IAA19 transcription. The IAA19 transcription activation by MYB77 is enhanced by direct interaction between MYB77 and PYL8 (PubMed:24894996). {ECO:0000269|PubMed:17675404, ECO:0000269|PubMed:24894996}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by auxin (PubMed:17675404). Down-regulated by potassium deprivation (PubMed:15173595). {ECO:0000269|PubMed:15173595, ECO:0000269|PubMed:17675404}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681823 | 0.0 | LN681823.1 Cucumis melo genomic scaffold, anchoredscaffold00014. | |||
GenBank | LN713257 | 0.0 | LN713257.1 Cucumis melo genomic chromosome, chr_3. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004152727.1 | 1e-128 | PREDICTED: transcription factor MYB44-like | ||||
Swissprot | Q9SN12 | 4e-54 | MYB77_ARATH; Transcription factor MYB77 | ||||
TrEMBL | A0A0A0LKY3 | 1e-127 | A0A0A0LKY3_CUCSA; Uncharacterized protein | ||||
STRING | XP_004169452.1 | 1e-128 | (Cucumis sativus) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF5074 | 32 | 56 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G50060.1 | 2e-56 | myb domain protein 77 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Cucsa.232630.1 |
Entrez Gene | 101203523 |
Publications ? help Back to Top | |||
---|---|---|---|
|