![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cucsa.205230.1 | ||||||||
Common Name | Csa_7G405980, LOC101220495 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 133aa MW: 14264.4 Da PI: 10.0025 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 61.9 | 7.8e-20 | 20 | 54 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 C++C++t TplWR gp g+++LCnaCG++yrk+++ Cucsa.205230.1 20 CVHCRATRTPLWRAGPAGPRSLCNACGIRYRKMKM 54 ********************************976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF57716 | 2.95E-14 | 12 | 57 | No hit | No description |
PROSITE profile | PS50114 | 12.571 | 14 | 50 | IPR000679 | Zinc finger, GATA-type |
SMART | SM00401 | 5.5E-12 | 14 | 72 | IPR000679 | Zinc finger, GATA-type |
Gene3D | G3DSA:3.30.50.10 | 2.1E-15 | 18 | 55 | IPR013088 | Zinc finger, NHR/GATA-type |
CDD | cd00202 | 7.66E-14 | 19 | 51 | No hit | No description |
PROSITE pattern | PS00344 | 0 | 20 | 45 | IPR000679 | Zinc finger, GATA-type |
Pfam | PF00320 | 4.3E-17 | 20 | 53 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 133 aa Download sequence Send to blast |
MTAVSKEGLL ELEAEKQRAC VHCRATRTPL WRAGPAGPRS LCNACGIRYR KMKMNSNNNG 60 GVNNNSNNKM GKGKKMGGSG GSLKVRVVRL GREIMVHRPT TAMEDDNEVA ESIGEEEQTA 120 ALLLMALSSG YV* |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681803 | 2e-64 | LN681803.1 Cucumis melo genomic scaffold, anchoredscaffold00026. | |||
GenBank | LN713255 | 2e-64 | LN713255.1 Cucumis melo genomic chromosome, chr_1. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011659382.1 | 2e-92 | PREDICTED: GATA transcription factor 15-like | ||||
TrEMBL | A0A0A0K6B1 | 4e-91 | A0A0A0K6B1_CUCSA; Uncharacterized protein | ||||
STRING | XP_004136159.1 | 3e-89 | (Cucumis sativus) | ||||
STRING | XP_004162445.1 | 3e-89 | (Cucumis sativus) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1569 | 32 | 98 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G06740.1 | 7e-22 | GATA transcription factor 15 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Cucsa.205230.1 |
Entrez Gene | 101220495 |
Publications ? help Back to Top | |||
---|---|---|---|
|