![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cucsa.202790.2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 96aa MW: 11064.9 Da PI: 10.3965 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 102.1 | 2e-32 | 9 | 58 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krienk+nrqvtfskRrng+lKKA+ELSvLCdaeva+iifs++gklye+ Cucsa.202790.2 9 KRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSTRGKLYEFG 58 79**********************************************95 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 1.5E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 33.403 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 3.37E-44 | 2 | 72 | No hit | No description |
SuperFamily | SSF55455 | 3.4E-34 | 2 | 79 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.8E-33 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 9.2E-28 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.8E-33 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.8E-33 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 96 aa Download sequence Send to blast |
MGRGRVELKR IENKINRQVT FSKRRNGLLK KAYELSVLCD AEVALIIFST RGKLYEFGSA 60 GTSKTLERYQ RCCFSPQHNF AERETQVLLL IPFFF* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 5e-22 | 1 | 69 | 1 | 69 | MEF2 CHIMERA |
6byy_B | 5e-22 | 1 | 69 | 1 | 69 | MEF2 CHIMERA |
6byy_C | 5e-22 | 1 | 69 | 1 | 69 | MEF2 CHIMERA |
6byy_D | 5e-22 | 1 | 69 | 1 | 69 | MEF2 CHIMERA |
6bz1_A | 5e-22 | 1 | 90 | 1 | 85 | MEF2 CHIMERA |
6bz1_B | 5e-22 | 1 | 90 | 1 | 85 | MEF2 CHIMERA |
6bz1_C | 5e-22 | 1 | 90 | 1 | 85 | MEF2 CHIMERA |
6bz1_D | 5e-22 | 1 | 90 | 1 | 85 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in flower development. {ECO:0000250|UniProtKB:Q0HA25}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KC899706 | 1e-138 | KC899706.1 Cucumis sativus AGL6-like MADS-box protein gene, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008460143.1 | 8e-56 | PREDICTED: agamous-like MADS-box protein AGL6 | ||||
Refseq | XP_008460144.1 | 8e-56 | PREDICTED: agamous-like MADS-box protein AGL6 | ||||
Swissprot | Q8LLR1 | 1e-49 | MADS3_VITVI; Agamous-like MADS-box protein MADS3 | ||||
TrEMBL | A0A0A0KCU5 | 1e-53 | A0A0A0KCU5_CUCSA; Uncharacterized protein | ||||
TrEMBL | A0A1S3CBY8 | 2e-54 | A0A1S3CBY8_CUCME; agamous-like MADS-box protein AGL6 | ||||
TrEMBL | W5REE7 | 4e-55 | W5REE7_CUCSA; AGL6-like MADS-box protein (Fragment) | ||||
STRING | XP_004153375.1 | 1e-56 | (Cucumis sativus) | ||||
STRING | XP_004174115.1 | 6e-57 | (Cucumis sativus) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G45650.1 | 2e-42 | AGAMOUS-like 6 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Cucsa.202790.2 |
Publications ? help Back to Top | |||
---|---|---|---|
|