PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Cucsa.125330.1

Common Name

Csa_4G361820, LOC101220287

Organism

Cucumis sativus

Taxonomic ID

3659

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis

Family

NAC

Protein Properties

Length: 225aa MW: 25631.8 Da PI: 8.7053

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Cucsa.125330.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	170.7	4.5e-53	7	131	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 lppGfrFhPtd+elv++yL++k++++++++ +i+e+d+yk++PwdLp+++ +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg dk++ + Cucsa.125330.1 7 LPPGFRFHPTDDELVTHYLCRKCASQPISV-PIIAEIDLYKYNPWDLPERALYGEKEWYFFSPRDRKYPNGSRPNRSAGSGYWKATGADKPIGR- 99 79**************************.88***********8777889*********************************98. PP NAM 96 kgelvglkktLvfykgrapkgektdWvmheyrl 128 ++vg+kk Lvfy+g+apkgekt+W+mheyrl Cucsa.125330.1 100 -PKAVGIKKALVFYSGKAPKGEKTNWIMHEYRL 131 .778*************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	2.09E-62	4	157	IPR003441	NAC domain
PROSITE profile	PS51005	60.791	7	157	IPR003441	NAC domain
Pfam	PF02365	3.7E-28	8	131	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 225 aa Download sequence Send to blast
MASDLQLPPG FRFHPTDDEL VTHYLCRKCA SQPISVPIIA EIDLYKYNPW DLPERALYGE 60 KEWYFFSPRD RKYPNGSRPN RSAGSGYWKA TGADKPIGRP KAVGIKKALV FYSGKAPKGE 120 KTNWIMHEYR LADVDRSARK KNSLRLDDWV LCRIYNKKGA IEKQNPPEMN TIGFFENEEQ 180 EEKPEILNDR AISGRIPSAS PLQGPPSSGV VNDYVYFDPS DSIPX

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3ulx_A	6e-84	3	163	11	174	Stress-induced transcription factor NAC1
Search in ModeBase

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KC814686	0.0	KC814686.1 Citrullus colocynthis NAC domain transcription factor 1 (NAC1) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004142632.1	1e-165	PREDICTED: NAC domain-containing protein 2-like
Swissprot	Q39013	1e-111	NAC2_ARATH; NAC domain-containing protein 2
TrEMBL	A0A0A0KYJ2	1e-164	A0A0A0KYJ2_CUCSA; Uncharacterized protein
STRING	XP_004161162.1	1e-165	(Cucumis sativus)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF1258	34	108

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G01720.1	1e-112	NAC family protein

Link Out ? help Back to Top
Phytozome	Cucsa.125330.1
Entrez Gene	101220287

Publications ? help Back to Top
Ren Y, et al. An integrated genetic and cytogenetic map of the cucumber genome. PLoS ONE, 2009. 4(6): p. e5795 [PMID:19495411] Guo S, et al. Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types. BMC Genomics, 2010. 11: p. 384 [PMID:20565788] Li Z, et al. RNA-Seq improves annotation of protein-coding genes in the cucumber genome. BMC Genomics, 2011. 12: p. 540 [PMID:22047402] Florentin A,Damri M,Grafi G Stress induces plant somatic cells to acquire some features of stem cells accompanied by selective chromatin reorganization. Dev. Dyn., 2013. 242(10): p. 1121-33 [PMID:23798027] Jensen MK, et al. ATAF1 transcription factor directly regulates abscisic acid biosynthetic gene NCED3 in Arabidopsis thaliana. FEBS Open Bio, 2013. 3: p. 321-7 [PMID:23951554] Wang YX Characterization of a novel Medicago sativa NAC transcription factor gene involved in response to drought stress. Mol. Biol. Rep., 2013. 40(11): p. 6451-8 [PMID:24057250] Yang X, et al. Overexpression of a Miscanthus lutarioriparius NAC gene MlNAC5 confers enhanced drought and cold tolerance in Arabidopsis. Plant Cell Rep., 2015. 34(6): p. 943-58 [PMID:25666276] Du Q,Wang H The role of HD-ZIP III transcription factors and miR165/166 in vascular development and secondary cell wall formation. Plant Signal Behav, 2015. 10(10): p. e1078955 [PMID:26340415] Takasaki H, et al. SNAC-As, stress-responsive NAC transcription factors, mediate ABA-inducible leaf senescence. Plant J., 2015. 84(6): p. 1114-23 [PMID:26518251] Liu Y,Sun J,Wu Y Arabidopsis ATAF1 enhances the tolerance to salt stress and ABA in transgenic rice. J. Plant Res., 2016. 129(5): p. 955-962 [PMID:27216423] Ghandchi FP,Caetano-Anolles G,Clough SJ,Ort DR Investigating the Control of Chlorophyll Degradation by Genomic Correlation Mining. PLoS ONE, 2016. 11(9): p. e0162327 [PMID:27618630] Zhao J,Missihoun TD,Bartels D The ATAF1 transcription factor is a key regulator of aldehyde dehydrogenase 7B4 (ALDH7B4) gene expression in Arabidopsis thaliana. Planta, 2018. 248(4): p. 1017-1027 [PMID:30027414]