PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.118200.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family WRKY
Protein Properties Length: 148aa    MW: 16379.3 Da    PI: 9.0615
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.118200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY108.43.4e-3479136259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +Dgy+WrKYGqK vk+s+fprsYY+Cts++C+vkk+vers+edp++v++tYeg+Hnh 
  Cucsa.118200.1  79 EDGYRWRKYGQKAVKNSPFPRSYYKCTSQNCSVKKRVERSSEDPSFVITTYEGKHNHY 136
                     8********************************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.8E-3565136IPR003657WRKY domain
SuperFamilySSF1182901.11E-2971138IPR003657WRKY domain
PROSITE profilePS5081132.29473138IPR003657WRKY domain
SMARTSM007744.8E-3978137IPR003657WRKY domain
PfamPF031062.0E-2779135IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 148 aa     Download sequence    Send to blast
MSCSSSEVIC SVDDALKKSS SLGRDLSSVV TGEHPSTPNC SSTTCSSDEV VAGGGKKKEK  60
REKGPRFAFL TKTEIDNLED GYRWRKYGQK AVKNSPFPRS YYKCTSQNCS VKKRVERSSE  120
DPSFVITTYE GKHNHYCPIT LRGHNPTG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A8e-30711381077Probable WRKY transcription factor 4
2lex_A8e-30711381077Probable WRKY transcription factor 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819211e-65LN681921.1 Cucumis melo genomic scaffold, anchoredscaffold00039.
GenBankLN7132651e-65LN713265.1 Cucumis melo genomic chromosome, chr_11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011656990.13e-85PREDICTED: probable WRKY transcription factor 12
SwissprotQ8VWJ22e-41WRK28_ARATH; WRKY transcription factor 28
SwissprotQ93WV42e-41WRK71_ARATH; WRKY transcription factor 71
TrEMBLA0A0A0KBC57e-84A0A0A0KBC5_CUCSA; Uncharacterized protein
STRINGXP_008456349.14e-83(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2467333
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29860.19e-44WRKY DNA-binding protein 71
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Kim SH, et al.
    Characterization of a Novel DWD protein that participates in heat stress response in Arabidopsis.
    Mol. Cells, 2014. 37(11): p. 833-40
    [PMID:25358503]
  4. Guo D, et al.
    The WRKY Transcription Factor WRKY71/EXB1 Controls Shoot Branching by Transcriptionally Regulating RAX Genes in Arabidopsis.
    Plant Cell, 2015. 27(11): p. 3112-27
    [PMID:26578700]
  5. Yu Y, et al.
    WRKY71 accelerates flowering via the direct activation of FLOWERING LOCUS T and LEAFY in Arabidopsis thaliana.
    Plant J., 2016. 85(1): p. 96-106
    [PMID:26643131]
  6. Guo D,Qin G
    EXB1/WRKY71 transcription factor regulates both shoot branching and responses to abiotic stresses.
    Plant Signal Behav, 2016. 11(3): p. e1150404
    [PMID:26914912]
  7. Yu Y, et al.
    WRKY71 Acts Antagonistically Against Salt-Delayed Flowering in Arabidopsis thaliana.
    Plant Cell Physiol., 2018. 59(2): p. 414-422
    [PMID:29272465]
  8. Zhao L, et al.
    KLU suppresses megasporocyte cell fate through SWR1-mediated activation of WRKY28 expression in Arabidopsis.
    Proc. Natl. Acad. Sci. U.S.A., 2018. 115(3): p. E526-E535
    [PMID:29288215]