PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis

Family

WRKY

Protein Properties

Length: 133aa MW: 15573.5 Da PI: 9.3183

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Cucsa.087850.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	101.2	6.2e-32	49	107	1	59
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK vk+++fprsYY+C+ +gC+vkk+++r ++d+ vv +tYeg H h+ Cucsa.087850.1 49 LDDGYRWRKYGQKAVKNNKFPRSYYKCSNEGCKVKKQIQRLTNDEGVVLTTYEGVHSHP 107 59********************************************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	5.7E-33	34	107	IPR003657	WRKY domain
SuperFamily	SSF118290	2.22E-28	42	108	IPR003657	WRKY domain
PROSITE profile	PS50811	29.138	44	109	IPR003657	WRKY domain
SMART	SM00774	2.9E-36	49	108	IPR003657	WRKY domain
Pfam	PF03106	6.4E-26	50	107	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 133 aa Download sequence Send to blast
MDEEEDDELE EERSLKKVKS EESGGELKKK KKIRKRRFAF ETRSQVDVLD DGYRWRKYGQ 60 KAVKNNKFPR SYYKCSNEGC KVKKQIQRLT NDEGVVLTTY EGVHSHPIEK PHDSFQNILT 120 HMHIYPSSSS SF*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	2e-27	39	106	7	74	Probable WRKY transcription factor 4
2lex_A	2e-27	39	106	7	74	Probable WRKY transcription factor 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. {ECO:0000250\|UniProtKB:Q9SI37}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	LN681815	3e-75	LN681815.1 Cucumis melo genomic scaffold, anchoredscaffold00008.
GenBank	LN713257	3e-75	LN713257.1 Cucumis melo genomic chromosome, chr_3.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004138624.2	2e-94	PREDICTED: probable WRKY transcription factor 45
Swissprot	Q9S763	1e-49	WRK45_ARATH; Probable WRKY transcription factor 45
TrEMBL	A0A0A0LT01	5e-93	A0A0A0LT01_CUCSA; Uncharacterized protein
STRING	XP_004138624.1	8e-94	(Cucumis sativus)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF1156	34	110

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G01970.1	4e-50	WRKY DNA-binding protein 45

Link Out ? help Back to Top
Phytozome	Cucsa.087850.1
Entrez Gene	101212622

Publications ? help Back to Top
Ren Y, et al. An integrated genetic and cytogenetic map of the cucumber genome. PLoS ONE, 2009. 4(6): p. e5795 [PMID:19495411] Guo S, et al. Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types. BMC Genomics, 2010. 11: p. 384 [PMID:20565788] Li Z, et al. RNA-Seq improves annotation of protein-coding genes in the cucumber genome. BMC Genomics, 2011. 12: p. 540 [PMID:22047402] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Chen L,Xiang S,Chen Y,Li D,Yu D Arabidopsis WRKY45 Interacts with the DELLA Protein RGL1 to Positively Regulate Age-Triggered Leaf Senescence. Mol Plant, 2017. 10(9): p. 1174-1189 [PMID:28735023]