![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cucsa.086660.5 | ||||||||
Common Name | Csa_6G426940, LOC101222154 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | YABBY | ||||||||
Protein Properties | Length: 143aa MW: 15840.8 Da PI: 10.7983 | ||||||||
Description | YABBY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | YABBY | 186.6 | 1.3e-57 | 1 | 133 | 31 | 170 |
YABBY 31 lfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesastsvsseklsenedeevprvppvirPPekrqrv 125 +f++vtvrCGhC++llsvn+ + q+++ ++ +++ + +++ + +++ + +++s+++s++ +l+++ +++ r+pp irPPekrqrv Cucsa.086660.5 1 MFTLVTVRCGHCSNLLSVNMGASLQVVPPQDS--QQG--HKQQQVNAGDSS--KDRASSSSSTKSTKIGSLDSSAERDQHRIPP-IRPPEKRQRV 88 699*************************9997..222..222222333332..3333344444555555688999999999999.9********* PP YABBY 126 PsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170 Psaynrfikeeiqrika+nPdishreafs+aaknWahfP+ihfgl Cucsa.086660.5 89 PSAYNRFIKEEIQRIKAKNPDISHREAFSTAAKNWAHFPHIHFGL 133 *******************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04690 | 4.0E-58 | 1 | 133 | IPR006780 | YABBY protein |
SuperFamily | SSF47095 | 6.81E-9 | 78 | 126 | IPR009071 | High mobility group box domain |
Gene3D | G3DSA:1.10.30.10 | 1.1E-5 | 81 | 127 | IPR009071 | High mobility group box domain |
CDD | cd01390 | 5.18E-6 | 87 | 123 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0007275 | Biological Process | multicellular organism development | ||||
GO:0010158 | Biological Process | abaxial cell fate specification |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 143 aa Download sequence Send to blast |
MFTLVTVRCG HCSNLLSVNM GASLQVVPPQ DSQQGHKQQQ VNAGDSSKDR ASSSSSTKST 60 KIGSLDSSAE RDQHRIPPIR PPEKRQRVPS AYNRFIKEEI QRIKAKNPDI SHREAFSTAA 120 KNWAHFPHIH FGLKLDGNKQ TK* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in the abaxial cell fate determination during embryogenesis and organogenesis. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681842 | 2e-60 | LN681842.1 Cucumis melo genomic scaffold, anchoredscaffold00022. | |||
GenBank | LN713259 | 2e-60 | LN713259.1 Cucumis melo genomic chromosome, chr_5. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004140176.1 | 1e-103 | PREDICTED: putative axial regulator YABBY 2 | ||||
Refseq | XP_011657596.1 | 1e-103 | PREDICTED: putative axial regulator YABBY 2 | ||||
Swissprot | Q9XFB0 | 2e-60 | YAB2_ARATH; Putative axial regulator YABBY 2 | ||||
TrEMBL | A0A0A0KGY1 | 1e-101 | A0A0A0KGY1_CUCSA; Uncharacterized protein | ||||
STRING | XP_004156064.1 | 1e-102 | (Cucumis sativus) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G08465.1 | 2e-57 | YABBY family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Cucsa.086660.5 |
Entrez Gene | 101222154 |
Publications ? help Back to Top | |||
---|---|---|---|
|