PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis

Family

MYB

Protein Properties

Length: 208aa MW: 24519.9 Da PI: 10.3181

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Cucsa.077160.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	58.1	2.1e-18	29	74	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg W + Ede+l ++v+q+G +W++Ia++++ gR++k+c++rw++ Cucsa.077160.1 29 RGHWRPAEDEKLRQLVEQYGAQNWNSIAEKLQ-GRSGKSCRLRWFNQ 74 899***************************.*********996 PP
2	Myb_DNA-binding	57.8	2.4e-18	81	124	1	46
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 r+++++eE+e+l+ a++ +G++ W++Iar ++ gRt++ +k++w+ Cucsa.077160.1 81 RKPFSEEEEERLLGAHRIHGNK-WSLIARLFP-GRTDNAVKNHWHV 124 789*****************.*****.*********96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	25.644	24	79	IPR017930	Myb domain
SuperFamily	SSF46689	3.33E-30	27	122	IPR009057	Homeodomain-like
SMART	SM00717	8.4E-15	28	77	IPR001005	SANT/Myb domain
Pfam	PF00249	1.7E-17	29	74	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	5.0E-27	30	82	IPR009057	Homeodomain-like
CDD	cd00167	1.20E-12	32	73	No hit	No description
PROSITE profile	PS51294	21.037	80	130	IPR017930	Myb domain
SMART	SM00717	4.9E-14	80	128	IPR001005	SANT/Myb domain
Pfam	PF00249	2.3E-15	81	123	IPR001005	SANT/Myb domain
CDD	cd00167	3.89E-10	83	123	No hit	No description
Gene3D	G3DSA:1.10.10.60	8.6E-21	83	129	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 208 aa Download sequence Send to blast
MKDSSGDHNN YNNNLHVNYH DQYKSSCPRG HWRPAEDEKL RQLVEQYGAQ NWNSIAEKLQ 60 GRSGKSCRLR WFNQLDPRII RKPFSEEEEE RLLGAHRIHG NKWSLIARLF PGRTDNAVKN 120 HWHVIMARKQ REQSKLCGNK RTYQQFSNLI LNNNQITTQS SSSTTNHHHH HHHHPQLTTT 180 TILVSDYNNN NSNSKDGMVW NFRQGFKX

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	8e-31	29	129	7	107	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that confers sensitivity to abscisic acid (ABA) and salt, but tolerance to drought (PubMed:21399993). Regulates secondary cell wall (SCW) biosynthesis, especially in interfascicular and xylary fibers (PubMed:18952777, PubMed:23781226). {ECO:0000269\|PubMed:18952777, ECO:0000269\|PubMed:21399993, ECO:0000269\|PubMed:23781226}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By abscisic acid (PubMed:16463103, PubMed:21399993). Accumulates in response to salt (PubMed:21399993). Triggered by MYB46 and MYB83 in the regulation of secondary cell wall biosynthesis (PubMed:19674407, PubMed:22197883). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:19674407, ECO:0000269\|PubMed:21399993, ECO:0000269\|PubMed:22197883}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	LN681815	0.0	LN681815.1 Cucumis melo genomic scaffold, anchoredscaffold00008.
GenBank	LN713257	0.0	LN713257.1 Cucumis melo genomic chromosome, chr_3.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004144300.2	1e-155	PREDICTED: transcription factor MYB57-like isoform X1
Swissprot	Q6R0C4	3e-65	MYB52_ARATH; Transcription factor MYB52
TrEMBL	A0A0A0KGJ9	1e-153	A0A0A0KGJ9_CUCSA; Uncharacterized protein
STRING	XP_004170710.1	1e-154	(Cucumis sativus)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF230	34	243

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G17950.1	9e-67	myb domain protein 52

Link Out ? help Back to Top
Phytozome	Cucsa.077160.1
Entrez Gene	101210851

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ren Y, et al. An integrated genetic and cytogenetic map of the cucumber genome. PLoS ONE, 2009. 4(6): p. e5795 [PMID:19495411] Guo S, et al. Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types. BMC Genomics, 2010. 11: p. 384 [PMID:20565788] Li Z, et al. RNA-Seq improves annotation of protein-coding genes in the cucumber genome. BMC Genomics, 2011. 12: p. 540 [PMID:22047402] Cassan-Wang H, et al. Identification of novel transcription factors regulating secondary cell wall formation in Arabidopsis. Front Plant Sci, 2013. 4: p. 189 [PMID:23781226] Shi D, et al. MYB52 Negatively Regulates Pectin Demethylesterification in Seed Coat Mucilage. Plant Physiol., 2018. 176(4): p. 2737-2749 [PMID:29440562]