PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina

Family

WRKY

Protein Properties

Length: 111aa MW: 12918.7 Da PI: 10.0496

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Csa20g051550.1	genome	CSGP	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	103.9	8.9e-33	49	107	1	59
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDg++WrKYG+K+vk+s++pr+YY+C+ gCpvkk+ver+++dp++v++tYeg+Hnh+ Csa20g051550.1 49 LDDGFKWRKYGKKMVKNSPNPRNYYKCSVDGCPVKKRVERDRDDPSFVITTYEGSHNHS 107 59********************************************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	8.2E-35	35	108	IPR003657	WRKY domain
SuperFamily	SSF118290	4.71E-29	42	107	IPR003657	WRKY domain
PROSITE profile	PS50811	30.182	44	109	IPR003657	WRKY domain
SMART	SM00774	2.4E-37	49	108	IPR003657	WRKY domain
Pfam	PF03106	3.5E-26	50	106	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 111 aa Download sequence Send to blast
MACLFGVHRS YADSVFSPYF PMQENQVKKE KKKVKERVAF KTRSEVEVLD DGFKWRKYGK 60 KMVKNSPNPR NYYKCSVDGC PVKKRVERDR DDPSFVITTY EGSHNHSSMN *

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	6e-27	39	106	7	74	Probable WRKY transcription factor 4
2lex_A	6e-27	39	106	7	74	Probable WRKY transcription factor 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Csa20g051550.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AY071847	1e-105	AY071847.1 Arabidopsis thaliana WRKY transcription factor 50 (WRKY50) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010421489.1	3e-59	PREDICTED: probable WRKY transcription factor 50
Refseq	XP_010493874.1	3e-59	PREDICTED: probable WRKY transcription factor 50
Swissprot	Q8VWQ5	4e-50	WRK50_ARATH; Probable WRKY transcription factor 50
TrEMBL	A0A397Y0Z1	5e-53	A0A397Y0Z1_BRACM; Uncharacterized protein
STRING	XP_010421489.1	1e-58	(Camelina sativa)
STRING	XP_010493874.1	1e-58	(Camelina sativa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM6121	27	47

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G26170.1	3e-52	WRKY DNA-binding protein 50

Publications ? help Back to Top
Brand LH,Kirchler T,Hummel S,Chaban C,Wanke D DPI-ELISA: a fast and versatile method to specify the binding of plant transcription factors to DNA in vitro. Plant Methods, 2010. 6: p. 25 [PMID:21108821]