![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Csa17090s010.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 99aa MW: 11022.3 Da PI: 9.415 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 75.3 | 9.9e-24 | 52 | 99 | 1 | 48 |
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSS CS SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsr 48 +Cq+egC+adls+ak+yhrrhkvCe+hska++v+++gl+qrfCqqCsr Csa17090s010.1 52 RCQAEGCNADLSHAKHYHRRHKVCEFHSKASTVVAAGLSQRFCQQCSR 99 6**********************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.1100.10 | 1.3E-25 | 48 | 99 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 20.64 | 50 | 99 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 1.31E-22 | 51 | 99 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 1.9E-17 | 53 | 99 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 99 aa Download sequence Send to blast |
KTEVDFTSNR IGLNLGGRTY FSAADDDFVS RLYRRSRPGE SGMGNSPLST PRCQAEGCNA 60 DLSHAKHYHR RHKVCEFHSK ASTVVAAGLS QRFCQQCSR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj0_A | 7e-18 | 53 | 99 | 6 | 52 | squamosa promoter-binding protein-like 12 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. Binds specifically to the 5'-GTAC-3' core sequence. Involved in development and floral organogenesis. Required for ovule differentiation, pollen production, filament elongation, seed formation and siliques elongation. Also seems to play a role in the formation of trichomes on sepals. May positively modulate gibberellin (GA) signaling in flower. {ECO:0000269|PubMed:12671094, ECO:0000269|PubMed:16095614, ECO:0000269|PubMed:17093870}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Csa17090s010.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AJ011641 | 2e-97 | AJ011641.1 Arabidopsis thaliana (ecotype Columbia) spl8 gene, exons 1-3. | |||
GenBank | AJ011642 | 2e-97 | AJ011642.1 Arabidopsis thaliana (ecotype Columbia) mRNA for squamosa promoter binding protein-like 8. | |||
GenBank | AK118174 | 2e-97 | AK118174.1 Arabidopsis thaliana At1g02065 mRNA for putative squamosa promoter binding protein 8 (SPL8), complete cds, clone: RAFL19-49-D21. | |||
GenBank | CP002684 | 2e-97 | CP002684.1 Arabidopsis thaliana chromosome 1 sequence. | |||
GenBank | U89959 | 2e-97 | U89959.1 Arabidopsis thaliana BAC T7I23, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010480322.1 | 1e-68 | PREDICTED: squamosa promoter-binding-like protein 8, partial | ||||
Swissprot | Q8GXL3 | 3e-64 | SPL8_ARATH; Squamosa promoter-binding-like protein 8 | ||||
TrEMBL | R0GQ55 | 2e-63 | R0GQ55_9BRAS; Uncharacterized protein | ||||
STRING | Cagra.1968s0141.1.p | 2e-66 | (Capsella grandiflora) | ||||
STRING | XP_010480322.1 | 5e-68 | (Camelina sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM7010 | 27 | 43 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G02065.2 | 4e-68 | squamosa promoter binding protein-like 8 |
Publications ? help Back to Top | |||
---|---|---|---|
|