![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Csa16g028710.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
Family | G2-like | ||||||||
Protein Properties | Length: 156aa MW: 17021 Da PI: 11.0485 | ||||||||
Description | G2-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | G2-like | 103.6 | 1.2e-32 | 16 | 71 | 1 | 56 |
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 k+r++W+peLH+rF++a++qLGGs++AtPk+i+++mkv+gLt+++vkSHLQkYRl+ Csa16g028710.1 16 KQRRCWSPELHRRFLNALQQLGGSHVATPKQIRDHMKVDGLTNDEVKSHLQKYRLH 71 79****************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46689 | 2.21E-18 | 13 | 74 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 14.821 | 13 | 73 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.3E-28 | 14 | 74 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 6.9E-28 | 16 | 71 | IPR006447 | Myb domain, plants |
Pfam | PF00249 | 1.3E-8 | 18 | 69 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 156 aa Download sequence Send to blast |
MTQQHQTQTQ SQTHRKQRRC WSPELHRRFL NALQQLGGSH VATPKQIRDH MKVDGLTNDE 60 VKSHLQKYRL HTRRPATTVA AQSNVNPQQP QFVVVGGIWV PSPQEFHPPT DAANNGGGVY 120 APVAVAAPSP KRSMERSCNS PGASSSTNTA TTPVS* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6j4r_A | 2e-14 | 16 | 69 | 1 | 54 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j4r_B | 2e-14 | 16 | 69 | 1 | 54 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j4r_C | 2e-14 | 16 | 69 | 1 | 54 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j4r_D | 2e-14 | 16 | 69 | 1 | 54 | Protein PHOSPHATE STARVATION RESPONSE 1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in phosphate homeostasis. Involved in the regulation of the developmental response of lateral roots, acquisition and/or mobilization of phosphate and expression of a subset of genes involved in phosphate sensing and signaling pathway. Is a target of the transcription factor PHR1. {ECO:0000269|PubMed:27016098}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Csa16g028710.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced under phosphate deprivation conditions. {ECO:0000269|PubMed:27016098}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010470826.1 | 1e-112 | PREDICTED: myb family transcription factor EFM | ||||
Swissprot | Q8VZS3 | 2e-79 | HHO2_ARATH; Transcription factor HHO2 | ||||
TrEMBL | R0IF32 | 9e-85 | R0IF32_9BRAS; Uncharacterized protein | ||||
STRING | XP_010470826.1 | 1e-112 | (Camelina sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM3491 | 28 | 63 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G68670.1 | 1e-53 | G2-like family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|