PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Csa14g038240.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 190aa MW: 21102.6 Da PI: 8.9969 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 107.4 | 1.2e-33 | 99 | 155 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 +ep++VNaKQy++Il+RRq+Rakle+++k+ +ksrkpylheSRh hA+rRpRg+gGrF Csa14g038240.1 99 EEPVFVNAKQYHGILRRRQSRAKLESQNKV-IKSRKPYLHESRHLHAIRRPRGCGGRF 155 69****************************.**************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 3.0E-38 | 97 | 158 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 38.764 | 98 | 158 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 6.0E-28 | 100 | 155 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 2.2E-24 | 101 | 123 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE pattern | PS00686 | 0 | 103 | 123 | IPR018362 | CCAAT-binding factor, conserved site |
PRINTS | PR00616 | 2.2E-24 | 132 | 155 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 190 aa Download sequence Send to blast |
MSCNIVSHEK QEQTDSQFQS PTPPGRNYES MATSLVYSEP VPPPHQGSTL PMAPGQYPYP 60 DPYYRSIFAP PPQQPYAGVH VQLMGMQQQG VPLPSDAVEE PVFVNAKQYH GILRRRQSRA 120 KLESQNKVIK SRKPYLHESR HLHAIRRPRG CGGRFLNAKK EDEHHEESHE DSSNLSSGKS 180 AMAASSGTS* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_A | 2e-22 | 98 | 165 | 1 | 68 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Csa14g038240.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT004274 | 1e-161 | BT004274.1 Arabidopsis thaliana clone RAFL15-46-O22 (R50095) putative transcription factor (At1g30500) mRNA, complete cds. | |||
GenBank | BT005561 | 1e-161 | BT005561.1 Arabidopsis thaliana clone U50095 putative transcription factor (At1g30500) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010460849.1 | 1e-138 | PREDICTED: nuclear transcription factor Y subunit A-7 isoform X2 | ||||
Swissprot | Q84JP1 | 1e-110 | NFYA7_ARATH; Nuclear transcription factor Y subunit A-7 | ||||
TrEMBL | R0I898 | 1e-116 | R0I898_9BRAS; Uncharacterized protein | ||||
STRING | XP_010460848.1 | 1e-135 | (Camelina sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4168 | 27 | 56 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G30500.2 | 2e-94 | nuclear factor Y, subunit A7 |
Publications ? help Back to Top | |||
---|---|---|---|
|