PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina

Family

NF-YB

Protein Properties

Length: 96aa MW: 10810.3 Da PI: 5.239

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Csa14271s010.1	genome	CSGP	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	154.9	1.4e-48	1	81	17	97
NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 mkk+lPanakiskdaket+qecvsefisfvt+easdkcq+ekrktingddllwa++tlGfedyveplkvyl+++re+ege+ Csa14271s010.1 1 MKKALPANAKISKDAKETMQECVSEFISFVTGEASDKCQKEKRKTINGDDLLWAMTTLGFEDYVEPLKVYLQRFREIEGER 81 9******************************************************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF00808	3.2E-22	1	55	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
SuperFamily	SSF47113	1.77E-33	1	89	IPR009072	Histone-fold
Gene3D	G3DSA:1.10.20.10	1.7E-43	1	83	IPR009072	Histone-fold
PRINTS	PR00615	1.9E-21	19	37	No hit	No description
PROSITE pattern	PS00685	0	22	38	IPR003956	Transcription factor, NFYB/HAP3, conserved site
PRINTS	PR00615	1.9E-21	38	56	No hit	No description
PRINTS	PR00615	1.9E-21	57	75	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 96 aa Download sequence Send to blast
MKKALPANAK ISKDAKETMQ ECVSEFISFV TGEASDKCQK EKRKTINGDD LLWAMTTLGF 60 EDYVEPLKVY LQRFREIEGE RTGLGRPQTG GEPGEH

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	9e-38	1	76	17	92	Transcription factor HapC (Eurofung)
4g92_B	9e-38	1	76	17	92	Transcription factor HapC (Eurofung)
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Csa14271s010.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB025628	1e-129	AB025628.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MNJ7.
GenBank	AF385744	1e-129	AF385744.1 Arabidopsis thaliana AT5g47640/MNJ7_23 mRNA, complete cds.
GenBank	AY078026	1e-129	AY078026.1 Arabidopsis thaliana AT5g47640/MNJ7_23 mRNA, complete cds.
GenBank	CP002688	1e-129	CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
GenBank	Y13724	1e-129	Y13724.1 Arabidopsis thaliana mRNA for Hap3b transcription factor.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010441427.1	1e-66	PREDICTED: nuclear transcription factor Y subunit B-2-like
Refseq	XP_010481289.1	1e-66	PREDICTED: nuclear transcription factor Y subunit B-2-like
Refseq	XP_010495002.1	1e-66	PREDICTED: nuclear transcription factor Y subunit B-2-like isoform X1
Refseq	XP_019098089.1	1e-66	PREDICTED: nuclear transcription factor Y subunit B-2-like isoform X2
Swissprot	Q9FGJ3	4e-66	NFYB2_ARATH; Nuclear transcription factor Y subunit B-2
TrEMBL	A0A078HTQ1	5e-64	A0A078HTQ1_BRANA; BnaA09g18400D protein
TrEMBL	A0A397XV65	5e-64	A0A397XV65_BRACM; Uncharacterized protein
TrEMBL	A0A3P6DUM0	5e-64	A0A3P6DUM0_BRAOL; Uncharacterized protein
TrEMBL	M4DLU2	5e-64	M4DLU2_BRARP; Uncharacterized protein
TrEMBL	V4N3P4	6e-64	V4N3P4_EUTSA; Uncharacterized protein
TrEMBL	W6DGI7	5e-64	W6DGI7_BRANA; BnaC09g20320D protein
STRING	XP_010441427.1	6e-66	(Camelina sativa)
STRING	XP_010481289.1	4e-66	(Camelina sativa)
STRING	XP_010495002.1	4e-66	(Camelina sativa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM255	28	229

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G47640.1	2e-68	nuclear factor Y, subunit B2

Publications ? help Back to Top
Hwang YH, et al. Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time. Plant Cell Rep., 2016. 35(4): p. 857-65 [PMID:26754793] Xu F, et al. DELLA proteins physically interact with CONSTANS to regulate flowering under long days in Arabidopsis. FEBS Lett., 2016. 590(4): p. 541-9 [PMID:26801684] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722] Gnesutta N, et al. CONSTANS Imparts DNA Sequence Specificity to the Histone Fold NF-YB/NF-YC Dimer. Plant Cell, 2017. 29(6): p. 1516-1532 [PMID:28526714]