PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina

Family

NAC

Protein Properties

Length: 252aa MW: 28224.3 Da PI: 7.2454

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Csa13g030320.1	genome	CSGP	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	164.3	4.5e-51	9	137	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 lp+GfrF+Ptdeelv++yL+ k++g++ ++ +vi+e+di+k+ePwdLp + vk++++ew fF++ d+ky++g+r nrat +gyWkatgkd++++ Csa13g030320.1 9 LPVGFRFSPTDEELVKYYLRLKINGHDDDV-RVIREIDICKWEPWDLPdfSVVKTTDSEWLFFCPLDRKYPSGSRMNRATVAGYWKATGKDRKIK 102 79***********************999.99***********6447888999*********************************** PP NAM 94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128 s k++ +g+k+tLvfy+grapkg++t W+mheyr+ Csa13g030320.1 103 SGKTKIIGVKRTLVFYTGRAPKGTRTCWIMHEYRA 137 9999***************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	2.62E-57	5	160	IPR003441	NAC domain
PROSITE profile	PS51005	54.615	9	160	IPR003441	NAC domain
Pfam	PF02365	1.5E-25	10	136	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 252 aa Download sequence Send to blast
MDVLSLASLP VGFRFSPTDE ELVKYYLRLK INGHDDDVRV IREIDICKWE PWDLPDFSVV 60 KTTDSEWLFF CPLDRKYPSG SRMNRATVAG YWKATGKDRK IKSGKTKIIG VKRTLVFYTG 120 RAPKGTRTCW IMHEYRATEK DLDGTKSGQN PFVICKLFKK QDIVNGAAPE DSKSCEVEPA 180 VSSPTVVDEM KSEVEMSEVS LVCLKTEDTK PSCDVTESSL LVSSECRSEN SAAEATTTGV 240 RMNKLHVFSL Q*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	1e-49	2	161	10	166	NO APICAL MERISTEM PROTEIN
1ut4_B	1e-49	2	161	10	166	NO APICAL MERISTEM PROTEIN
1ut7_A	1e-49	2	161	10	166	NO APICAL MERISTEM PROTEIN
1ut7_B	1e-49	2	161	10	166	NO APICAL MERISTEM PROTEIN
3swm_A	1e-49	2	161	13	169	NAC domain-containing protein 19
3swm_B	1e-49	2	161	13	169	NAC domain-containing protein 19
3swm_C	1e-49	2	161	13	169	NAC domain-containing protein 19
3swm_D	1e-49	2	161	13	169	NAC domain-containing protein 19
3swp_A	1e-49	2	161	13	169	NAC domain-containing protein 19
3swp_B	1e-49	2	161	13	169	NAC domain-containing protein 19
3swp_C	1e-49	2	161	13	169	NAC domain-containing protein 19
3swp_D	1e-49	2	161	13	169	NAC domain-containing protein 19
4dul_A	1e-49	2	161	10	166	NAC domain-containing protein 19
4dul_B	1e-49	2	161	10	166	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator essential for the anti-viral defense called virus basal resistance response pathway (PubMed:11041886, PubMed:15629774, PubMed:18785827, PubMed:24418554). Not involved in HRT-mediated hypersensitive response (HR) and resistance to TCV (PubMed:18785827). Binds DNA non specifically (PubMed:15629774). Activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (By similarity). {ECO:0000250\|UniProtKB:Q9SCK6, ECO:0000269\|PubMed:11041886, ECO:0000269\|PubMed:15629774, ECO:0000269\|PubMed:18785827, ECO:0000269\|PubMed:24418554}.; FUNCTION: (Microbial infection) Compromised function in defense response pathway when interacting with the invading viral capsid protein (CP) of turnip crinkle virus (TCV) due to abnormal subcellular localization. {ECO:0000269\|PubMed:11041886, ECO:0000269\|PubMed:15629774}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Csa13g030320.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by bacterial pathogens type III effector proteins (TTEs). {ECO:0000269\|PubMed:16553893}.; INDUCTION: (Microbial infection) Accumulates 2 days post infection with turnip crinkle virus (TCV) (PubMed:24418554). {ECO:0000269\|PubMed:24418554}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010456676.1	1e-175	PREDICTED: NAC domain-containing protein 91-like
Swissprot	Q9LKG8	1e-153	NAC91_ARATH; NAC domain-containing protein 91
TrEMBL	R0GUL8	1e-164	R0GUL8_9BRAS; Uncharacterized protein
TrEMBL	R0H6V5	1e-164	R0H6V5_9BRAS; Uncharacterized protein
STRING	XP_010456676.1	1e-174	(Camelina sativa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM2416	28	73

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G24590.2	1e-135	TCV-interacting protein

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ben Daniel BH, et al. Identification of novel transcriptional regulators of Zat12 using comprehensive yeast one-hybrid screens. Physiol Plant, 2016. 157(4): p. 422-41 [PMID:26923089] Li Y, et al. The interaction between Turnip crinkle virus p38 and Cucumber mosaic virus 2b and its critical domains. Virus Res., 2016. 222: p. 94-105 [PMID:27288723]