PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Csa13g015420.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 285aa MW: 32066.1 Da PI: 5.7363 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 44.3 | 4.1e-14 | 21 | 68 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g W++eEd +l ++ G g+W+ +a+ g+ R++k+c++rw +yl Csa13g015420.1 21 KGLWSPEEDSKLMQYMLSNGQGCWSDVAKNAGLQRCGKSCRLRWINYL 68 678*******************************************97 PP | |||||||
2 | Myb_DNA-binding | 48.8 | 1.6e-15 | 74 | 117 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg+++++E++l+++ + lG++ W+ Ia++++ gRt++++k++w++ Csa13g015420.1 74 RGAFSPQEEDLIIRFHSILGNR-WSQIAARLP-GRTDNEIKNFWNS 117 89********************.*********.***********97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 14.842 | 16 | 68 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.09E-27 | 19 | 115 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.0E-10 | 20 | 70 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.1E-13 | 21 | 68 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.3E-22 | 22 | 75 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.59E-8 | 24 | 68 | No hit | No description |
PROSITE profile | PS51294 | 24.449 | 69 | 123 | IPR017930 | Myb domain |
SMART | SM00717 | 2.3E-15 | 73 | 121 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.7E-14 | 74 | 117 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 2.6E-25 | 76 | 124 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 9.98E-11 | 76 | 116 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 285 aa Download sequence Send to blast |
MRKPEVAIAA ATTHQVKKMK KGLWSPEEDS KLMQYMLSNG QGCWSDVAKN AGLQRCGKSC 60 RLRWINYLRP DLKRGAFSPQ EEDLIIRFHS ILGNRWSQIA ARLPGRTDNE IKNFWNSTIK 120 KRLKKMSDTS NLINNSSSSP NTTSDSSSNS TSSLELKDII GSFMSLQEPG FINPSLTQIP 180 TNNPFPAPNM ISHPCNDDFT PYVDGIYGVN TGVQGDLYFP PLECEEGDWY NININNNHLD 240 ELNTNGSGNA PESMIRPVEE LWDLDQLMMN TEVPSFYFNF KQSI* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 8e-28 | 21 | 123 | 7 | 108 | B-MYB |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator. Involved in the regulation of secondary wall biosynthesis in fibers and vessels (PubMed:17890373). Transcription activator of the mannan synthase CSLA9 that recognizes and binds to the DNA consensus sequence 5'-[AG][GT]T[AT]GGT[GA]-3' cis-regulatory element of CSLA9 promoter (PubMed:24243147). Transcription factor that acts as molecular switch in the NAC012/SND1-mediated transcriptional network regulating secondary wall biosynthesis. Is directly activated by NAC012/SND1. Functions redundantly with MYB83 in the transcriptional regulatory cascade leading to secondary wall formation in fibers and vessels (PubMed:19808805). Transcription activator that binds to the DNA consensus sequence 5'-ACC[AT]A[AC][TC]-3', designated as the secondary wall MYB-responsive element (SMRE). Regulates directly numerous transcription factors and a number of genes involved in secondary wall biosynthesis that contain SMRE elements in their promoters (PubMed:22197883). Is an obligate component of the transcriptional regulatory complex toward the commitment of secondary wall cellulose synthesis. Is required for functional expression of the three secondary wall CESA genes, CESA4, CESA7 and CESA8 (PubMed:23726771). {ECO:0000269|PubMed:17890373, ECO:0000269|PubMed:19808805, ECO:0000269|PubMed:22197883, ECO:0000269|PubMed:23726771, ECO:0000269|PubMed:24243147}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Csa13g015420.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Slightly induced by salicylic acid (SA). Positively regulated by SND1 and homolog proteins. {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:17890373}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY519621 | 0.0 | AY519621.1 Arabidopsis thaliana MYB transcription factor (At5g12870) mRNA, complete cds. | |||
GenBank | BT000455 | 0.0 | BT000455.1 Arabidopsis thaliana putative transcription factor (MYB46) (At5g12870) mRNA, complete cds. | |||
GenBank | BT002549 | 0.0 | BT002549.1 Arabidopsis thaliana putative transcription factor (MYB46) (At5g12870) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010453337.1 | 0.0 | PREDICTED: transcription factor MYB46-like | ||||
Swissprot | Q9LXV2 | 1e-176 | MYB46_ARATH; Transcription factor MYB46 | ||||
TrEMBL | D7M538 | 1e-175 | D7M538_ARALL; AtMYB46 | ||||
STRING | XP_010453337.1 | 0.0 | (Camelina sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM6115 | 23 | 47 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G12870.1 | 1e-173 | myb domain protein 46 |
Publications ? help Back to Top | |||
---|---|---|---|
|