PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina

Family

WRKY

Protein Properties

Length: 102aa MW: 11937.3 Da PI: 9.0806

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Csa11g101950.2	genome	CSGP	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	88.9	4.2e-28	16	74	1	59
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 +dDg++WrKYG+K+vk++ + r+YY+C+s+gC+vkk+ver+ ed +v++tY g Hnhe Csa11g101950.2 16 MDDGFKWRKYGKKSVKNNINKRNYYKCSSEGCSVKKRVERDGEDAAYVITTYDGVHNHE 74 69********************************************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	7.3E-31	3	76	IPR003657	WRKY domain
SuperFamily	SSF118290	1.7E-26	8	76	IPR003657	WRKY domain
PROSITE profile	PS50811	28.495	11	76	IPR003657	WRKY domain
SMART	SM00774	1.8E-30	16	75	IPR003657	WRKY domain
Pfam	PF03106	2.7E-22	17	74	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0007264	Biological Process	small GTPase mediated signal transduction
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0005525	Molecular Function	GTP binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 102 aa Download sequence Send to blast
MGHRVAFRTR SKIDVMDDGF KWRKYGKKSV KNNINKRNYY KCSSEGCSVK KRVERDGEDA 60 AYVITTYDGV HNHESPSHVY YNEMVLSYDH DNWNQHSLLQ C*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	5e-24	6	77	7	78	Probable WRKY transcription factor 4
2lex_A	5e-24	6	77	7	78	Probable WRKY transcription factor 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). Involved in defense responses. May act as positive regulator of salicylic acid (SA)-mediated signaling and negative regulator of jasmonic acid (JA)-mediated signaling (PubMed:21030507). {ECO:0000250, ECO:0000269\|PubMed:21030507}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Csa11g101950.2

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB493813	1e-122	AB493813.1 Arabidopsis thaliana At5g64810 mRNA for hypothetical protein, partial cds, clone: RAAt5g64810.
GenBank	AF426252	1e-122	AF426252.1 Arabidopsis thaliana WRKY transcription factor 51 (WRKY51) mRNA, complete cds.
GenBank	BT025755	1e-122	BT025755.1 Arabidopsis thaliana At5g64810 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010444429.1	4e-72	PREDICTED: probable WRKY transcription factor 51
Swissprot	Q93WU9	2e-66	WRK51_ARATH; Probable WRKY transcription factor 51
TrEMBL	R0GSB1	5e-68	R0GSB1_9BRAS; Uncharacterized protein
STRING	XP_010444429.1	2e-71	(Camelina sativa)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G64810.1	8e-69	WRKY DNA-binding protein 51

Publications ? help Back to Top
Yan C, et al. Injury Activates Ca2+/Calmodulin-Dependent Phosphorylation of JAV1-JAZ8-WRKY51 Complex for Jasmonate Biosynthesis. Mol. Cell, 2018. 70(1): p. 136-149.e7 [PMID:29625034]