PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Csa11g097420.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
Family | AP2 | ||||||||
Protein Properties | Length: 227aa MW: 25637.6 Da PI: 5.9207 | ||||||||
Description | AP2 family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | AP2 | 24.2 | 8.3e-08 | 111 | 138 | 2 | 32 |
AP2 2 gykGVrwdkkrgrWvAeIrdpsengkrkrfs 32 +y+GVr+++ +g+++AeIrdp + r++ Csa11g097420.1 111 HYRGVRRRP-WGKFAAEIRDPAKK--GSRIW 138 7********.**********8443..26666 PP | |||||||
2 | AP2 | 38.1 | 3.7e-12 | 140 | 181 | 12 | 55 |
AP2 12 rgrWvAeIrdpsengkrkrfslgkfgtaeeAakaaiaarkkleg 55 +g+++AeIrdp + k r++lg+f + +Aa+a++ a+ kl+g Csa11g097420.1 140 WGKFAAEIRDPAK--KGSRIWLGTFESDIDAARAYDYAAFKLRG 181 9*********954..34*************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:3.30.730.10 | 4.1E-11 | 110 | 138 | IPR001471 | AP2/ERF domain |
SMART | SM00380 | 2.6E-31 | 111 | 195 | IPR001471 | AP2/ERF domain |
CDD | cd00018 | 1.24E-15 | 111 | 189 | No hit | No description |
SuperFamily | SSF54171 | 2.09E-6 | 111 | 138 | IPR016177 | DNA-binding domain |
Pfam | PF00847 | 4.5E-9 | 111 | 181 | IPR001471 | AP2/ERF domain |
PROSITE profile | PS51032 | 23.815 | 111 | 189 | IPR001471 | AP2/ERF domain |
PRINTS | PR00367 | 4.2E-13 | 112 | 123 | IPR001471 | AP2/ERF domain |
SuperFamily | SSF54171 | 6.02E-19 | 133 | 190 | IPR016177 | DNA-binding domain |
Gene3D | G3DSA:3.30.730.10 | 1.5E-23 | 139 | 190 | IPR001471 | AP2/ERF domain |
PRINTS | PR00367 | 4.2E-13 | 171 | 191 | IPR001471 | AP2/ERF domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 227 aa Download sequence Send to blast |
MATLEESSDM DVILQKHLFD DLMIPDDFIE DFVFDDTVFV SGLWSLEPFN QPVPKLEPSS 60 PVLDPDSYVQ EFLQVEAESS SSSSSSSITS PEVETVSNWE KTKRFEETTR HYRGVRRRPW 120 GKFAAEIRDP AKKGSRIWPW GKFAAEIRDP AKKGSRIWLG TFESDIDAAR AYDYAAFKLR 180 GRKAVLNFPL DAGKYDAPVN SCRKRRRSDV PQPRGTRTST SSSSSN* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2gcc_A | 2e-23 | 110 | 190 | 4 | 64 | ATERF1 |
3gcc_A | 2e-23 | 110 | 190 | 4 | 64 | ATERF1 |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 202 | 206 | RKRRR |
2 | 202 | 207 | RKRRRS |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probably acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. May be involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways (By similarity). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Csa11g097420.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB012239 | 1e-144 | AB012239.1 Arabidopsis thaliana genomic DNA, chromosome 5, TAC clone:K11J9. | |||
GenBank | AY045968 | 1e-144 | AY045968.1 Arabidopsis thaliana putative ethylene responsive element binding factor (At5g61590) mRNA, complete cds. | |||
GenBank | AY079321 | 1e-144 | AY079321.1 Arabidopsis thaliana putative ethylene responsive element binding factor (At5g61590) mRNA, complete cds. | |||
GenBank | CP002688 | 1e-144 | CP002688.1 Arabidopsis thaliana chromosome 5 sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010443982.1 | 1e-123 | PREDICTED: ethylene-responsive transcription factor ERF107-like | ||||
Swissprot | Q9FKG2 | 1e-101 | EF107_ARATH; Ethylene-responsive transcription factor ERF107 | ||||
TrEMBL | A0A078GEM0 | 1e-104 | A0A078GEM0_BRANA; BnaC07g31340D protein | ||||
TrEMBL | A0A0D3DDN4 | 1e-104 | A0A0D3DDN4_BRAOL; Uncharacterized protein | ||||
TrEMBL | M4D8X9 | 1e-104 | M4D8X9_BRARP; Uncharacterized protein | ||||
STRING | XP_010443982.1 | 1e-122 | (Camelina sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM3229 | 27 | 66 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G61590.1 | 1e-101 | ERF family protein |