PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina

Family

M-type_MADS

Protein Properties

Length: 135aa MW: 15441 Da PI: 9.8936

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Csa11g028480.1	genome	CSGP	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	101.2	3.8e-32	73	123	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvtf+kRrng+lKKA+ELSvLCd+eva+i+fss+g+lyeys+ Csa11g028480.1 73 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDVEVALIVFSSRGRLYEYSN 123 79***********************************************95 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	32.618	65	125	IPR002100	Transcription factor, MADS-box
SMART	SM00432	6.1E-40	65	124	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	7.46E-30	66	125	IPR002100	Transcription factor, MADS-box
CDD	cd00265	4.37E-41	66	126	No hit	No description
PRINTS	PR00404	6.9E-33	67	87	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	67	121	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	2.8E-27	74	121	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.9E-33	87	102	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	6.9E-33	102	123	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 135 aa Download sequence Send to blast
MCIYSSLHQH NLTFHFLQLL QISYFPENHF PKKNNTFLFV LLPPTAITAY QPELGGGDSS 60 PLRKSGRGKI EIKRIENTTN RQVTFCKRRN GLLKKAYELS VLCDVEVALI VFSSRGRLYE 120 YSNNRFLLIL VLCS*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	1e-19	66	131	2	67	Myocyte-specific enhancer factor 2B
1tqe_Q	1e-19	66	131	2	67	Myocyte-specific enhancer factor 2B
1tqe_R	1e-19	66	131	2	67	Myocyte-specific enhancer factor 2B
1tqe_S	1e-19	66	131	2	67	Myocyte-specific enhancer factor 2B
3mu6_A	1e-19	66	123	1	58	Myocyte-specific enhancer factor 2A
3mu6_B	1e-19	66	123	1	58	Myocyte-specific enhancer factor 2A
3mu6_C	1e-19	66	123	1	58	Myocyte-specific enhancer factor 2A
3mu6_D	1e-19	66	123	1	58	Myocyte-specific enhancer factor 2A
6c9l_A	1e-19	66	131	2	67	Myocyte-specific enhancer factor 2B
6c9l_B	1e-19	66	131	2	67	Myocyte-specific enhancer factor 2B
6c9l_C	1e-19	66	131	2	67	Myocyte-specific enhancer factor 2B
6c9l_D	1e-19	66	131	2	67	Myocyte-specific enhancer factor 2B
6c9l_E	1e-19	66	131	2	67	Myocyte-specific enhancer factor 2B
6c9l_F	1e-19	66	131	2	67	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in the control of organ identity during the early development of flowers. Is required for normal development of stamens and carpels in the wild-type flower. Plays a role in maintaining the determinacy of the floral meristem. Acts as C class cadastral protein by repressing the A class floral homeotic genes like APETALA1. Forms a heterodimer via the K-box domain with either SEPALATTA1/AGL2, SEPALATTA2/AGL4, SEPALLATA3/AGL9 or AGL6 that could be involved in genes regulation during floral meristem development. Controls AHL21/GIK, a multifunctional chromatin modifier in reproductive organ patterning and differentiation (PubMed:19956801). Induces microsporogenesis through the activation of SPL/NZZ (PubMed:15254538). {ECO:0000269\|PubMed:15254538, ECO:0000269\|PubMed:19956801}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Csa11g028480.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Negatively regulated by the A class floral homeotic protein APETALA2 and by other repressors like LEUNIG, SEUSS, SAP or CURLY LEAF. Positively regulated by both LEAFY and APETALA1. Repressed by silencing mediated by polycomb group (PcG) protein complex containing EMF1 and EMF2. Up-regulated by HUA2. {ECO:0000269\|PubMed:10198637, ECO:0000269\|PubMed:11058164, ECO:0000269\|PubMed:1675158, ECO:0000269\|PubMed:17794879, ECO:0000269\|PubMed:18281509, ECO:0000269\|PubMed:19783648, ECO:0000269\|PubMed:9783581}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	EU551773	1e-157	EU551773.1 Capsella bursa-pastoris AGAMOUS-like protein (AGb) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010445284.1	2e-87	PREDICTED: floral homeotic protein AGAMOUS
Swissprot	P17839	1e-44	AG_ARATH; Floral homeotic protein AGAMOUS
TrEMBL	D7M9D0	3e-72	D7M9D0_ARALL; Uncharacterized protein
STRING	XP_010445284.1	6e-87	(Camelina sativa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM78	28	413

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G18960.1	1e-47	MIKC_MADS family protein

Publications ? help Back to Top
Huang Z, et al. APETALA2 antagonizes the transcriptional activity of AGAMOUS in regulating floral stem cells in Arabidopsis thaliana. New Phytol., 2017. 215(3): p. 1197-1209 [PMID:27604611] Rong XF, et al. Type-B ARRs Control Carpel Regeneration Through Mediating AGAMOUS Expression in Arabidopsis. Plant Cell Physiol., 2018. 59(4): p. 756-764 [PMID:29186581] Uemura A, et al. Regulation of floral meristem activity through the interaction of AGAMOUS, SUPERMAN, and CLAVATA3 in Arabidopsis. Plant Reprod, 2018. 31(1): p. 89-105 [PMID:29218596]