![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Csa09068s010.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 120aa MW: 13166.9 Da PI: 6.3383 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 114.3 | 7.7e-36 | 2 | 87 | 14 | 99 |
DUF260 14 kdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 ++C++apyfp e+p+kfanvhk+FGasnv+kll++l +++reda++sl+yeAear+rdPvyG+vg i+ lq+q+++l++el+++++ Csa09068s010.1 2 PGCIFAPYFPPEEPHKFANVHKIFGASNVTKLLNELLPHQREDAVNSLAYEAEARVRDPVYGCVGAISYLQRQVHRLQKELDAANA 87 78*******************************************************************************99876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 22.451 | 1 | 89 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 1.1E-34 | 2 | 86 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 120 aa Download sequence Send to blast |
MPGCIFAPYF PPEEPHKFAN VHKIFGASNV TKLLNELLPH QREDAVNSLA YEAEARVRDP 60 VYGCVGAISY LQRQVHRLQK ELDAANADLA HYGLSTSAGG TPGNVVDLVF QPQPLQSQQP |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 2e-55 | 1 | 102 | 23 | 123 | LOB family transfactor Ramosa2.1 |
5ly0_B | 2e-55 | 1 | 102 | 23 | 123 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Not known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Csa09068s010.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB008265 | 1e-168 | AB008265.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MDC12. | |||
GenBank | AB164305 | 1e-168 | AB164305.1 Arabidopsis thaliana ASL4 mRNA for ASYMMETRIC LEAVES2-like gene 4 protein, partial cds. | |||
GenBank | AB473837 | 1e-168 | AB473837.1 Arabidopsis thaliana ASL4 mRNA for ASYMMETRIC LEAVES2-like 4 protein, complete cds. | |||
GenBank | AF447897 | 1e-168 | AF447897.1 Arabidopsis thaliana LOBa (LOB) mRNA, complete cds; alternatively spliced. | |||
GenBank | BT025745 | 1e-168 | BT025745.1 Arabidopsis thaliana At5g63090 mRNA, complete cds. | |||
GenBank | CP002688 | 1e-168 | CP002688.1 Arabidopsis thaliana chromosome 5 sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010444183.1 | 3e-84 | PREDICTED: protein LATERAL ORGAN BOUNDARIES-like | ||||
Refseq | XP_010444184.1 | 3e-84 | PREDICTED: protein LATERAL ORGAN BOUNDARIES-like | ||||
Swissprot | Q9FML4 | 1e-81 | LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES | ||||
TrEMBL | R0GRT8 | 1e-79 | R0GRT8_9BRAS; Uncharacterized protein | ||||
STRING | XP_010444183.1 | 1e-83 | (Camelina sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM131 | 28 | 340 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G63090.4 | 5e-84 | LBD family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|