![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Csa02g044820.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 197aa MW: 22757.6 Da PI: 10.2859 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 90.5 | 8.4e-29 | 13 | 63 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+ien + rqvtfskRr g++KKA+ELSvLCda+va i+fs++g+lyeyss Csa02g044820.1 13 KKIENVTSRQVTFSKRRSGLFKKAHELSVLCDAQVAAIVFSQSGRLYEYSS 63 68***********************************************96 PP | |||||||
2 | K-box | 70.1 | 7e-24 | 88 | 176 | 10 | 98 |
K-box 10 eeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 e+ ++l++e++++ k+i+ L+ +R+l+G++L+s+s+ eLq++ +q+eksl+ +Rs+K el+ q+e+l++ke+el +e k+Lr+++ Csa02g044820.1 88 VERYLQELKKEMDRMVKKIDLLEVHHRKLMGQGLGSCSVAELQEIDTQIEKSLRIVRSRKAELYAGQLEKLKEKERELLNERKRLREEV 176 5667899*******************************************************************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 2.8E-40 | 5 | 64 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 31.497 | 5 | 65 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 3.14E-33 | 7 | 94 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.20E-42 | 7 | 80 | No hit | No description |
PRINTS | PR00404 | 2.2E-29 | 7 | 27 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 3.1E-26 | 14 | 61 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.2E-29 | 27 | 42 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.2E-29 | 42 | 63 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 13.366 | 92 | 182 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 6.4E-23 | 92 | 176 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 197 aa Download sequence Send to blast |
MAGKMVRGKI EIKKIENVTS RQVTFSKRRS GLFKKAHELS VLCDAQVAAI VFSQSGRLYE 60 YSSSEMEKII ERYGKFSNNS FVAERPQVER YLQELKKEMD RMVKKIDLLE VHHRKLMGQG 120 LGSCSVAELQ EIDTQIEKSL RIVRSRKAEL YAGQLEKLKE KERELLNERK RLREEVITHT 180 LILVLASVAL NFKAMLG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 2e-20 | 5 | 77 | 1 | 73 | MEF2 CHIMERA |
6byy_B | 2e-20 | 5 | 77 | 1 | 73 | MEF2 CHIMERA |
6byy_C | 2e-20 | 5 | 77 | 1 | 73 | MEF2 CHIMERA |
6byy_D | 2e-20 | 5 | 77 | 1 | 73 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MADS-box transcription factor that acts with AGL42 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1. {ECO:0000269|PubMed:21609362}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Csa02g044820.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY141220 | 0.0 | AY141220.1 Arabidopsis thaliana MADS-box protein AGL71 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019087845.1 | 1e-121 | PREDICTED: MADS-box protein AGL71-like isoform X1 | ||||
Swissprot | Q9LT93 | 1e-110 | AGL71_ARATH; MADS-box protein AGL71 | ||||
TrEMBL | R0GS21 | 1e-109 | R0GS21_9BRAS; Uncharacterized protein | ||||
STRING | XP_010444025.1 | 1e-119 | (Camelina sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM78 | 28 | 413 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G51870.1 | 3e-98 | AGAMOUS-like 71 |