PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina

Family

M-type_MADS

Protein Properties

Length: 62aa MW: 6949.13 Da PI: 10.7083

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Csa02g044810.1	genome	CSGP	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	91.5	4.2e-29	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+ien + rqvtfskRr g++KKA+ELSvLCda+va +ifs++g+lye++s Csa02g044810.1 9 KKIENVTSRQVTFSKRRSGLFKKAHELSVLCDAQVAAMIFSQKGRLYEFAS 59 78***********************************************86 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	1.8E-39	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	31.244	1	61	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	1.57E-28	3	60	IPR002100	Transcription factor, MADS-box
CDD	cd00265	1.42E-35	3	60	No hit	No description
PRINTS	PR00404	5.2E-30	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.8E-26	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	5.2E-30	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	5.2E-30	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 62 aa Download sequence Send to blast
MVRGKIEIKK IENVTSRQVT FSKRRSGLFK KAHELSVLCD AQVAAMIFSQ KGRLYEFASS 60 E*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	3e-17	1	61	1	61	Myocyte-specific enhancer factor 2B
1tqe_Q	3e-17	1	61	1	61	Myocyte-specific enhancer factor 2B
1tqe_R	3e-17	1	61	1	61	Myocyte-specific enhancer factor 2B
1tqe_S	3e-17	1	61	1	61	Myocyte-specific enhancer factor 2B
6c9l_A	3e-17	1	61	1	61	Myocyte-specific enhancer factor 2B
6c9l_B	3e-17	1	61	1	61	Myocyte-specific enhancer factor 2B
6c9l_C	3e-17	1	61	1	61	Myocyte-specific enhancer factor 2B
6c9l_D	3e-17	1	61	1	61	Myocyte-specific enhancer factor 2B
6c9l_E	3e-17	1	61	1	61	Myocyte-specific enhancer factor 2B
6c9l_F	3e-17	1	61	1	61	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	MADS-box transcription factor that acts with AGL42 and AGL71 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1. {ECO:0000269\|PubMed:21609362}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Csa02g044810.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB025623	5e-78	AB025623.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MJM18.
GenBank	CP002688	5e-78	CP002688.1 Arabidopsis thaliana chromosome 5 sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001078745.1	1e-35	K-box region and MADS-box transcription factor family protein
Swissprot	Q9FLH5	1e-36	AGL72_ARATH; MADS-box protein AGL72
TrEMBL	A0A178UL76	2e-34	A0A178UL76_ARATH; AGL72
STRING	AT5G51860.1	6e-35	(Arabidopsis thaliana)
STRING	scaffold_801621.1	5e-35	(Arabidopsis lyrata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM78	28	413

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G51860.2	4e-39	MIKC_MADS family protein

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546]