![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Csa01g013950.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 240aa MW: 27574.9 Da PI: 7.2778 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 47 | 5.8e-15 | 16 | 63 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+W+ eE e+l +++ G +W++ ++ g+ R++k+c++rw +yl Csa01g013950.1 16 RGPWSDEESERLRAFIEKNGHQNWRSLPKLAGLMRCGKSCRLRWINYL 63 89********************************************97 PP | |||||||
2 | Myb_DNA-binding | 55.5 | 1.3e-17 | 69 | 114 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T+eE++ ++++++ +G++ W++Ia++++ gRt++++k+ w+++l Csa01g013950.1 69 RGNFTKEEEDTIIHLHQAHGNK-WSKIASHFP-GRTDNEIKNVWNTHL 114 89********************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 2.4E-21 | 7 | 66 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 16.139 | 11 | 63 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.02E-29 | 14 | 110 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 9.0E-10 | 15 | 65 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.9E-13 | 16 | 63 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.36E-7 | 18 | 63 | No hit | No description |
PROSITE profile | PS51294 | 25.442 | 64 | 118 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.8E-28 | 67 | 118 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 4.5E-16 | 68 | 116 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.5E-16 | 69 | 114 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 9.50E-11 | 71 | 114 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 240 aa Download sequence Send to blast |
MGKRRAPCCD KSQVRRGPWS DEESERLRAF IEKNGHQNWR SLPKLAGLMR CGKSCRLRWI 60 NYLRPGLKRG NFTKEEEDTI IHLHQAHGNK WSKIASHFPG RTDNEIKNVW NTHLKKRLMK 120 RKSSSSSEED VTNHSVSSTS SSSSSVSSVL KDVIINSEKP NQEEEFEEIF MEQMACGFEV 180 NAPQSLECLF GDSHILPPIS KPDLLEIHGK SDHEFWSRLV EPGFDDYNEW LNFLDNQTC* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 9e-23 | 16 | 118 | 7 | 108 | B-MYB |
1gv2_A | 1e-22 | 16 | 118 | 4 | 105 | MYB PROTO-ONCOGENE PROTEIN |
1mse_C | 1e-22 | 16 | 118 | 4 | 105 | C-Myb DNA-Binding Domain |
1msf_C | 1e-22 | 16 | 118 | 4 | 105 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in metal ions homeostasis, including iron ions (Fe) acquisition, via the regulation of NAS4 and NAS2 genes expression. Necessary for plant survival in alkaline soil where iron availability is greatly restricted. Triggers tolerance to nickel (Ni) and zinc (Zn) ions. {ECO:0000269|PubMed:24278034}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Csa01g013950.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Accumulates strongly in the root stele and in the outer layers of the lateral roots when exposed to iron (Fe)-deficient conditions (PubMed:24278034). Slightly induced by ethylene and by darkness conditions (PubMed:9839469). Accumulates upon potassium (K) depletion (PubMed:15489280). Induced by zinc (Zn) and cadmium (Cd) ions (PubMed:18088336). {ECO:0000269|PubMed:15489280, ECO:0000269|PubMed:18088336, ECO:0000269|PubMed:24278034, ECO:0000269|PubMed:9839469}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY519586 | 0.0 | AY519586.1 Arabidopsis thaliana MYB transcription factor (At3g12820) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010499552.1 | 1e-178 | PREDICTED: myb-related protein Zm1 | ||||
Swissprot | Q9LTV4 | 1e-143 | MYB10_ARATH; Transcription factor MYB10 | ||||
TrEMBL | R0HT36 | 1e-138 | R0HT36_9BRAS; Uncharacterized protein | ||||
STRING | XP_010499552.1 | 1e-178 | (Camelina sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM14096 | 16 | 24 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G12820.1 | 1e-125 | myb domain protein 10 |
Publications ? help Back to Top | |||
---|---|---|---|
|