PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Csa00478s020.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 173aa MW: 20075.3 Da PI: 5.6617 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 51.5 | 2.2e-16 | 80 | 138 | 5 | 63 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 +++rr+++NRe+ArrsR RK+ ++eL v L eN++L ++l++l++ ++k+ +e+ Csa00478s020.1 80 RKQRRMISNRESARRSRMRKQRHLDELWSQVMWLRIENHQLLDKLNNLSESYEKVLQEN 138 689****************************************************9998 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 2.5E-15 | 76 | 140 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 6.7E-12 | 78 | 134 | No hit | No description |
PROSITE profile | PS50217 | 11.07 | 78 | 141 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 7.5E-13 | 80 | 134 | No hit | No description |
Pfam | PF00170 | 1.3E-14 | 80 | 138 | IPR004827 | Basic-leucine zipper domain |
CDD | cd14702 | 9.95E-19 | 81 | 131 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 83 | 98 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 173 aa Download sequence Send to blast |
MQPQTDVFNL HNYLNSSIPS PYPSSVTIST PFPSNCQNSN PLYGFQISTN NPQSMSLSSN 60 NSTSDEAEEH QTNNNIINER KQRRMISNRE SARRSRMRKQ RHLDELWSQV MWLRIENHQL 120 LDKLNNLSES YEKVLQENAQ LKEETSELKE VISNMQIQSP FSCFRDDIIP IE* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 92 | 99 | RRSRMRKQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Csa00478s020.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB016878 | 0.0 | AB016878.1 Arabidopsis thaliana genomic DNA, chromosome 3, P1 clone: MQP15. | |||
GenBank | CP002686 | 0.0 | CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010496052.1 | 1e-122 | PREDICTED: basic leucine zipper 43-like | ||||
Swissprot | Q9FMC2 | 5e-63 | BZP43_ARATH; Basic leucine zipper 43 | ||||
TrEMBL | A0A078JMC7 | 1e-105 | A0A078JMC7_BRANA; BnaA06g39730D protein | ||||
TrEMBL | A0A397Z2R0 | 1e-105 | A0A397Z2R0_BRACM; Uncharacterized protein | ||||
STRING | XP_010496052.1 | 1e-122 | (Camelina sativa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM3112 | 26 | 67 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G30530.1 | 3e-95 | basic leucine-zipper 42 |
Publications ? help Back to Top | |||
---|---|---|---|
|