![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cotton_A_27959_BGI-A2_v1.0 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | bHLH | ||||||||
Protein Properties | Length: 89aa MW: 9865.21 Da PI: 7.5141 | ||||||||
Description | bHLH family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HLH | 26.8 | 9.2e-09 | 16 | 56 | 14 | 54 |
HHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS HLH 14 driNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54 d+i + ++L++l+P++++ +s K s + +L+++++YI++L Cotton_A_27959_BGI-A2_v1.0 16 DQITHLVSKLQQLIPELCARRSHKASASKVLQETCDYIRNL 56 57788889********88*********************99 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50888 | 9.058 | 2 | 56 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
SuperFamily | SSF47459 | 1.83E-8 | 16 | 74 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
Pfam | PF00010 | 4.5E-6 | 16 | 56 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
Gene3D | G3DSA:4.10.280.10 | 1.1E-8 | 17 | 71 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009741 | Biological Process | response to brassinosteroid | ||||
GO:0009826 | Biological Process | unidimensional cell growth | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 89 aa Download sequence Send to blast |
MSGRRSGSGV SSISDDQITH LVSKLQQLIP ELCARRSHKA SASKVLQETC DYIRNLHKEV 60 EDLSDRLSQL LASIDTDKDQ AAIVRSLLM |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Atypical and probable non DNA-binding bHLH transcription factor that integrates multiple signaling pathways to regulate cell elongation and plant development. May have a regulatory role in various aspects of gibberellin-dependent growth and development. {ECO:0000269|PubMed:16527868}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016675571.1 | 2e-57 | PREDICTED: transcription factor PRE6-like | ||||
Refseq | XP_017647757.1 | 2e-57 | PREDICTED: transcription factor PRE6-like | ||||
Swissprot | Q9LJX1 | 2e-32 | PRE5_ARATH; Transcription factor PRE5 | ||||
TrEMBL | A0A1U8IBH6 | 5e-56 | A0A1U8IBH6_GOSHI; transcription factor PRE6-like | ||||
STRING | Gorai.013G083800.1 | 9e-54 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM259 | 28 | 225 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G26945.1 | 6e-34 | bHLH family protein |