![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cotton_A_26446_BGI-A2_v1.0 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 119aa MW: 13539.7 Da PI: 10.6973 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 59.4 | 4.6e-19 | 16 | 49 | 1 | 34 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 C+ C tt TplWR gp g+++LCnaCG++yrkk+ Cotton_A_26446_BGI-A2_v1.0 16 CVDCSTTRTPLWRGGPAGPRSLCNACGIRYRKKN 49 ********************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50114 | 13.217 | 10 | 46 | IPR000679 | Zinc finger, GATA-type |
SMART | SM00401 | 9.2E-15 | 10 | 66 | IPR000679 | Zinc finger, GATA-type |
SuperFamily | SSF57716 | 6.18E-14 | 11 | 50 | No hit | No description |
Gene3D | G3DSA:3.30.50.10 | 7.0E-16 | 14 | 50 | IPR013088 | Zinc finger, NHR/GATA-type |
CDD | cd00202 | 9.45E-13 | 15 | 50 | No hit | No description |
PROSITE pattern | PS00344 | 0 | 16 | 41 | IPR000679 | Zinc finger, GATA-type |
Pfam | PF00320 | 7.3E-17 | 16 | 50 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 119 aa Download sequence Send to blast |
MNILQQSEFK ETNKRCVDCS TTRTPLWRGG PAGPRSLCNA CGIRYRKKNR ALLGLNRESR 60 SEKSKRGIEV RRSGIKLKSF GREVGMQHMV GNRELKSKLR EEEEAAFLLM ALSCGYVYA |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. {ECO:0000250}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017629766.1 | 1e-82 | PREDICTED: GATA transcription factor 15-like | ||||
Swissprot | Q8LG10 | 5e-27 | GAT15_ARATH; GATA transcription factor 15 | ||||
TrEMBL | A0A2P5WVS0 | 2e-81 | A0A2P5WVS0_GOSBA; Uncharacterized protein | ||||
STRING | Gorai.007G125000.1 | 2e-81 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM17347 | 6 | 11 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G16141.1 | 2e-21 | GATA family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|