![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cotton_A_22531_BGI-A2_v1.0 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 150aa MW: 16799.9 Da PI: 6.5282 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 174.3 | 1.3e-54 | 36 | 131 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplk 84 +eqdr+lPianv+rimk++lP nakisk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++walatlGf++y+e+lk Cotton_A_22531_BGI-A2_v1.0 36 KEQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDVCWALATLGFDNYAEQLK 118 89********************************************************************************* PP NF-YB 85 vylkkyrelegek 97 yl++yre ege+ Cotton_A_22531_BGI-A2_v1.0 119 RYLHRYREQEGER 131 **********997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 8.4E-53 | 33 | 142 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 9.78E-40 | 38 | 143 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.4E-27 | 41 | 105 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.1E-19 | 69 | 87 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 72 | 88 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.1E-19 | 88 | 106 | No hit | No description |
PRINTS | PR00615 | 1.1E-19 | 107 | 125 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 150 aa Download sequence Send to blast |
MADKIGINNL DSEGLKYNFA TGAASSVLSG EDGIIKEQDR LLPIANVGRI MKQILPPNAK 60 ISKEAKETMQ ECVSEFISFV TGEASDKCHK EKRKTVNGDD VCWALATLGF DNYAEQLKRY 120 LHRYREQEGE RVSQNRAIER SDSSLATRPF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 2e-45 | 35 | 126 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 2e-45 | 35 | 126 | 1 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017625044.1 | 1e-109 | PREDICTED: nuclear transcription factor Y subunit B-5-like | ||||
Swissprot | O82248 | 1e-60 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | A0A2P5XNV6 | 1e-108 | A0A2P5XNV6_GOSBA; Uncharacterized protein | ||||
STRING | Gorai.004G141600.1 | 1e-108 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM255 | 28 | 229 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 6e-63 | nuclear factor Y, subunit B5 |
Publications ? help Back to Top | |||
---|---|---|---|
|