 |
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
Cotton_A_07763_BGI-A2_v1.0 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
Family |
BES1 |
Protein Properties |
Length: 104aa MW: 11617 Da PI: 9.4234 |
Description |
BES1 family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
Cotton_A_07763_BGI-A2_v1.0 | genome | BGI | View CDS |
|
Signature Domain? help Back to Top |
 |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | DUF822 | 111.8 | 1.1e-34 | 20 | 85 | 12 | 77 |
DUF822 12 rEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskple 77
rEnn+rRE+ RRa akiy G RaqGny+lpk+ +nneVlkALc+ AGwvvedDGttyr+ +++
Cotton_A_07763_BGI-A2_v1.0 20 RENNRRREKGRRATVAKIYNGPRAQGNYNLPKHYNNNEVLKALCAKAGWVVEDDGTTYRNKVIHEN 85
9**********************************************************7766553 PP
|
3D Structure ? help Back to Top |
 |
PDB ID |
Evalue |
Query Start |
Query End |
Hit Start |
Hit End |
Description |
5zd4_A | 8e-19 | 32 | 78 | 391 | 437 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
5zd4_B | 8e-19 | 32 | 78 | 391 | 437 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
5zd4_C | 8e-19 | 32 | 78 | 391 | 437 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
5zd4_D | 8e-19 | 32 | 78 | 391 | 437 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
Search in ModeBase |
Annotation --
Nucleotide ? help
Back to Top |
Source |
Hit ID |
E-value |
Description |
GenBank | JX589267 | 2e-84 | JX589267.1 Gossypium hirsutum clone NBRI_GE23932 microsatellite sequence. |