![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cotton_A_07550_BGI-A2_v1.0 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 198aa MW: 23234.6 Da PI: 9.6554 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 93.6 | 9.5e-30 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien + rqvtfskRrng+lKKA+EL vLCdaevaviifs++gklye+ss Cotton_A_07550_BGI-A2_v1.0 9 KRIENATSRQVTFSKRRNGLLKKAYELYVLCDAEVAVIIFSHKGKLYEFSS 59 79***********************************************96 PP | |||||||
2 | K-box | 69.8 | 8.6e-24 | 84 | 171 | 10 | 97 |
K-box 10 eeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenk 92 ++ +++l+ e++++ k+ie L+ ++R++lG++L+s+s+ eLq++e+qLe+sl++iR++K l++eqi +l+ ke+ +qeen Cotton_A_07550_BGI-A2_v1.0 84 FDRYTQQLRLEAENMAKKIEFLEVSKRRMLGQNLGSCSIDELQEVENQLERSLRNIRARKGYLFKEQILQLKAKERYMQEENA 166 5677899**************************************************************************** PP K-box 93 aLrkk 97 +L++k Cotton_A_07550_BGI-A2_v1.0 167 KLSAK 171 **987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 32.001 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.7E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 7.69E-42 | 3 | 76 | No hit | No description |
PRINTS | PR00404 | 6.3E-31 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 8.76E-33 | 3 | 75 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 8.2E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.3E-31 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 6.3E-31 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 13.645 | 88 | 183 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 4.5E-23 | 88 | 171 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009838 | Biological Process | abscission | ||||
GO:0009909 | Biological Process | regulation of flower development | ||||
GO:0010150 | Biological Process | leaf senescence | ||||
GO:0080187 | Biological Process | floral organ senescence | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 198 aa Download sequence Send to blast |
MVRGKIQMKR IENATSRQVT FSKRRNGLLK KAYELYVLCD AEVAVIIFSH KGKLYEFSSS 60 DNMQNTIERY RQYKKDVQSN IPEFDRYTQQ LRLEAENMAK KIEFLEVSKR RMLGQNLGSC 120 SIDELQEVEN QLERSLRNIR ARKGYLFKEQ ILQLKAKERY MQEENAKLSA KNNGTTCSQQ 180 NAEVETELFL GLPENRCS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 1e-18 | 1 | 79 | 1 | 78 | MEF2C |
5f28_B | 1e-18 | 1 | 79 | 1 | 78 | MEF2C |
5f28_C | 1e-18 | 1 | 79 | 1 | 78 | MEF2C |
5f28_D | 1e-18 | 1 | 79 | 1 | 78 | MEF2C |
6byy_A | 1e-18 | 1 | 79 | 1 | 78 | MEF2 CHIMERA |
6byy_B | 1e-18 | 1 | 79 | 1 | 78 | MEF2 CHIMERA |
6byy_C | 1e-18 | 1 | 79 | 1 | 78 | MEF2 CHIMERA |
6byy_D | 1e-18 | 1 | 79 | 1 | 78 | MEF2 CHIMERA |
6bz1_A | 1e-18 | 1 | 79 | 1 | 78 | MEF2 CHIMERA |
6bz1_B | 1e-18 | 1 | 79 | 1 | 78 | MEF2 CHIMERA |
6bz1_C | 1e-18 | 1 | 79 | 1 | 78 | MEF2 CHIMERA |
6bz1_D | 1e-18 | 1 | 79 | 1 | 78 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1 (PubMed:21609362). Plays a role in controlling flower organ senescence and abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA (PubMed:21689171). {ECO:0000269|PubMed:21609362, ECO:0000269|PubMed:21689171}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00576 | DAP | Transfer from AT5G62165 | Download |
![]() |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HM236430 | 0.0 | HM236430.1 Gossypium hirsutum MADS15 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017609908.1 | 1e-143 | PREDICTED: MADS-box protein AGL42-like isoform X1 | ||||
Swissprot | Q9FIS1 | 7e-79 | AGL42_ARATH; MADS-box protein AGL42 | ||||
TrEMBL | A0A2P5WMY4 | 1e-141 | A0A2P5WMY4_GOSBA; Uncharacterized protein | ||||
STRING | Gorai.007G009800.1 | 1e-135 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM78 | 28 | 413 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G62165.3 | 3e-81 | AGAMOUS-like 42 |