![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cotton_A_06263_BGI-A2_v1.0 | ||||||||
Common Name | F383_09870 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 182aa MW: 20248.5 Da PI: 8.7023 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 138.3 | 2.1e-43 | 59 | 135 | 2 | 78 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 Cqve+C +dls ak+yhrrhkvCe+h+kap v+v+g++qrfCqqCsrfhelsefDe+krsCr+rLa+hnerrrk++a Cotton_A_06263_BGI-A2_v1.0 59 CQVEKCGVDLSVAKRYHRRHKVCEIHAKAPIVVVAGIRQRFCQQCSRFHELSEFDEAKRSCRSRLAGHNERRRKSSA 135 **************************************************************************976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.1100.10 | 1.8E-35 | 56 | 120 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 32.445 | 56 | 133 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 8.11E-40 | 57 | 136 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 1.4E-33 | 59 | 132 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010321 | Biological Process | regulation of vegetative phase change | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 182 aa Download sequence Send to blast |
MNKDFMAEDV DNDMEEEGGG EEEEEGAVYH GVQDDEKKKK ASGRRGSSGG VGGVLPPSCQ 60 VEKCGVDLSV AKRYHRRHKV CEIHAKAPIV VVAGIRQRFC QQCSRFHELS EFDEAKRSCR 120 SRLAGHNERR RKSSAESSAE GSSRKGTSPQ LKEGHCRQVD DQRARVPITI PGNSSFKRSH 180 IR |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 1e-36 | 46 | 132 | 1 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Promotes both vegetative phase change and flowering. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:16914499}. | |||||
UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Promotes both vegetative phase change and flowering. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:16914499}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00634 | PBM | Transfer from PK22320.1 | Download |
![]() |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Negatively regulated by microRNAs miR156 and miR157. {ECO:0000305|PubMed:12202040, ECO:0000305|PubMed:16914499}. | |||||
UniProt | INDUCTION: Negatively regulated by microRNAs miR156. {ECO:0000269|PubMed:16914499}. |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | JX614763 | 1e-172 | JX614763.1 Gossypium hirsutum clone NBRI_GE58393 microsatellite sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017639066.1 | 1e-130 | PREDICTED: squamosa promoter-binding protein 1 | ||||
Swissprot | Q9S758 | 1e-46 | SPL5_ARATH; Squamosa promoter-binding-like protein 5 | ||||
Swissprot | Q9S7A9 | 8e-47 | SPL4_ARATH; Squamosa promoter-binding-like protein 4 | ||||
TrEMBL | A0A0B0PK17 | 1e-129 | A0A0B0PK17_GOSAR; Squamosa promoter-binding-like protein 5 | ||||
STRING | Gorai.002G068300.1 | 1e-129 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM868 | 28 | 118 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G15270.1 | 8e-39 | squamosa promoter binding protein-like 5 |