![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cotton_A_06141_BGI-A2_v1.0 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
|
||||||||
Family | bHLH | ||||||||
Protein Properties | Length: 92aa MW: 10344.7 Da PI: 10.1049 | ||||||||
Description | bHLH family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HLH | 25.8 | 1.9e-08 | 20 | 59 | 15 | 54 |
HHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS HLH 15 riNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54 +i + ++L++l+P++ + +s K+s + +L+++++YI+sL Cotton_A_06141_BGI-A2_v1.0 20 QIIDLVSKLQQLIPELRGRRSDKVSASKVLQETCNYIRSL 59 5667779********88*********************99 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50888 | 10.442 | 5 | 59 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
Gene3D | G3DSA:4.10.280.10 | 3.2E-8 | 19 | 73 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
Pfam | PF00010 | 7.3E-6 | 20 | 59 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
SuperFamily | SSF47459 | 1.83E-8 | 20 | 76 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 92 aa Download sequence Send to blast |
MSSRRSRSRQ SGASRITDDQ IIDLVSKLQQ LIPELRGRRS DKVSASKVLQ ETCNYIRSLH 60 REVDGLSDRL SQLLASTDTD SDQAAIIRSL LM |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Atypical and probable non DNA-binding bHLH transcription factor that integrates multiple signaling pathways to regulate cell elongation and plant development. May have a regulatory role in various aspects of gibberellin-dependent growth and development. {ECO:0000269|PubMed:16527868}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016704509.1 | 2e-57 | PREDICTED: transcription factor PRE6-like | ||||
Refseq | XP_017636815.1 | 2e-57 | PREDICTED: transcription factor PRE6-like | ||||
Swissprot | Q9LJX1 | 1e-40 | PRE5_ARATH; Transcription factor PRE5 | ||||
TrEMBL | A0A1U8KUV4 | 6e-56 | A0A1U8KUV4_GOSHI; transcription factor PRE6-like | ||||
TrEMBL | A0A2P5Q5S4 | 6e-56 | A0A2P5Q5S4_GOSBA; Uncharacterized protein | ||||
STRING | Gorai.008G181800.1 | 4e-56 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM259 | 28 | 225 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G26945.1 | 2e-39 | bHLH family protein |