PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium

Family

MYB_related

Protein Properties

Length: 99aa MW: 11847.6 Da PI: 10.4722

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Cotton_A_02240_BGI-A2_v1.0	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	56.9	4.9e-18	10	57	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT++Ed lv+ v+++G ++W+ Ia+ g++Rt+k+c++rw +yl Cotton_A_02240_BGI-A2_v1.0 10 KGPWTEQEDAVLVNFVHLFGDRRWDFIAKVSGLNRTGKSCRLRWVNYL 57 79********************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	6.3E-20	3	60	IPR009057	Homeodomain-like
PROSITE profile	PS51294	24.074	5	61	IPR017930	Myb domain
SMART	SM00717	2.8E-15	9	59	IPR001005	SANT/Myb domain
Pfam	PF00249	1.3E-16	10	57	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	7.81E-22	11	86	IPR009057	Homeodomain-like
CDD	cd00167	2.60E-11	12	57	No hit	No description
Gene3D	G3DSA:1.10.10.60	2.2E-6	61	85	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 99 aa Download sequence Send to blast
MKAEQEETRK GPWTEQEDAV LVNFVHLFGD RRWDFIAKVS GLNRTGKSCR LRWVNYLHPG 60 LKREKMSPQE QRLVLELHAK WGNRFHFTSP FNHHMISFL

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1gv2_A	1e-15	10	85	4	78	MYB PROTO-ONCOGENE PROTEIN
1h88_C	4e-15	10	85	58	132	MYB PROTO-ONCOGENE PROTEIN
1h89_C	4e-15	10	85	58	132	MYB PROTO-ONCOGENE PROTEIN
1mse_C	1e-15	10	85	4	78	C-Myb DNA-Binding Domain
1msf_C	1e-15	10	85	4	78	C-Myb DNA-Binding Domain
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. {ECO:0000305}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Isoform MYB59-1 is induced by jasmonate (JA), salicylic acid (SA), gibberellic acid (GA), and ethylene. Also induced by cadmium (Cd). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:16531467}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AJ459143	3e-56	AJ459143.1 Gossypium hirsutum partial myb115c gene, clone pGhMYB115c.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_016740582.1	8e-57	PREDICTED: transcription factor MYB59-like isoform X1
Refseq	XP_016755977.1	8e-57	PREDICTED: transcription factor MYB59-like isoform X1
Refseq	XP_017618648.1	9e-57	PREDICTED: transcription factor MYB59 isoform X1
Swissprot	Q4JL84	1e-50	MYB59_ARATH; Transcription factor MYB59
TrEMBL	A0A0B0NST8	2e-55	A0A0B0NST8_GOSAR; Transcription factor MYB48-like protein
TrEMBL	A0A1U8NNK8	2e-55	A0A1U8NNK8_GOSHI; transcription factor MYB59-like isoform X1
TrEMBL	A0A1U8PXV5	2e-55	A0A1U8PXV5_GOSHI; transcription factor MYB59-like isoform X1
TrEMBL	A0A2P5QNA2	2e-55	A0A2P5QNA2_GOSBA; Uncharacterized protein
STRING	Gorai.003G136400.1	1e-53	(Gossypium raimondii)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM2502	27	74

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G59780.3	5e-53	myb domain protein 59

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Nishida S,Kakei Y,Shimada Y,Fujiwara T Genome-wide analysis of specific alterations in transcript structure and accumulation caused by nutrient deficiencies in Arabidopsis thaliana. Plant J., 2017. 91(4): p. 741-753 [PMID:28586097] Hickman R, et al. Architecture and Dynamics of the Jasmonic Acid Gene Regulatory Network. Plant Cell, 2017. 29(9): p. 2086-2105 [PMID:28827376]